Recombinant Mormopterus kalinowskii Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondria

MT-CYB is the core subunit of Complex III (ubiquinol-cytochrome c reductase), a key component of the mitochondrial electron transport chain :

  • Role: Facilitates electron transfer from ubiquinol to cytochrome c, generating a proton gradient for ATP synthesis .

  • Catalytic Domains:

    • Q₀ Site: Binds ubiquinol and inhibitors (e.g., atovaquone) .

    • Qᵢ Site: Mediates cytochrome c reduction .

Mutations in MT-CYB (e.g., p.Phe18Leu, p.Asp171Asn) alter drug sensitivity and complex activity, as demonstrated in yeast models of human mtDNA variants . While M. kalinowskii MT-CYB has not been directly studied for functional mutations, its structural homology to human MT-CYB suggests conserved mechanisms .

Disease Modeling

Recombinant MT-CYB enables studies on mitochondrial disorders linked to Complex III dysfunction. For example:

  • Antiviral/Drug Interactions: Atovaquone (antimalarial) binds the Q₀ site, altering ATP production .

  • Mitochondrial Diseases: Mutations in MT-CYB correlate with Complex III deficiency, leading to multi-organ failure .

Evolutionary Studies

  • Phylogenetic Analysis: Cytochrome b sequences are used to trace bat evolution, as seen in Keenocardium buelowi studies .

  • Positive Selection: cob genes in marine species exhibit adaptive evolution, suggesting functional diversification .

Comparative Analysis with Other Bats

Recombinant cytochrome b proteins from related bat species are also available:

SpeciesCatalog NumberExpression System
Eumops glaucinusCSB-CF654264EBACE. coli
Lasionycteris noctivagansCSB-CF654942LBAIE. coli
Tadarida brasiliensisCSB-CF657773TAIE. coli

These proteins share structural homology but differ in application-specific modifications (e.g., His-tag positioning) .

Challenges and Future Directions

  • Limited Functional Data: Most studies focus on human or yeast MT-CYB; M. kalinowskii variants remain understudied.

  • Therapeutic Potential: Insights from drug-binding studies (e.g., atovaquone) may inform antiviral or anticancer strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Mormopterus kalinowskii (Kalinowski's mastiff bat)
Target Names
Target Protein Sequence
MTNIRKSHPLIKIVNDAFIDLPAPSNISSWWNFGSLLGVCLTVQILTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHVGRGLYYGSYTYTETWNVGVILL FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. It contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.