Recombinant Mortierella alpina Cytochrome b5

Shipped with Ice Packs
In Stock

Description

Cloning and Heterologous Expression

The cytochrome b5 gene was cloned using synthetic oligonucleotides based on internal peptide sequences . Expression in E. coli yielded a soluble form constituting 16% of total soluble protein, though only 8% was holo-cytochrome b5 (heme-bound active form) . Challenges in achieving high holo-cytochrome yields suggest limitations in co-factor incorporation during bacterial expression.

Table 2: Expression Yields in E. coli

ParameterValueSource
Total Soluble Protein16%
Holo-Cytochrome b58%

Functional and Spectral Characterization

Purified recombinant cytochrome b5 exhibits spectral properties consistent with fungal microsomal cytochrome b5:

  • Oxidized State: Absorbance peaks at ~413 nm (Soret band) and ~528 nm (Q-band) .

  • Reduced State: Shifts in absorption spectra confirm redox activity, critical for electron transfer during fatty acid metabolism .

Comparative Analysis with Other Cytochrome b5s

While exact sequence identity percentages are not reported, structural and functional similarities to mammalian and yeast homologs underscore conserved roles in electron transport . For example:

  • Flavin-Binding Domains: Conserved arginine, tyrosine, and serine residues in M. alpina cytochrome b5 align with those in human and yeast CbRs, suggesting analogous interaction mechanisms .

Biotechnological Applications

Recombinant cytochrome b5 could enhance PUFA biosynthesis in engineered microorganisms:

  • Fatty Acid Desaturation: As a redox partner for Δ5-desaturases, it may improve arachidonic acid yields in heterologous hosts like Aspergillus oryzae .

  • Industrial Strain Optimization: Insights into its structure-function relationships could inform strain engineering for lipid production .

Challenges and Future Directions

  • Low Holo-Cytochrome Yields: Optimization of co-factor synthesis (e.g., heme) in bacterial systems is needed .

  • Functional Interactions: Further studies on its role in the M. alpina electron transport chain and coordination with Δ5-desaturases are required .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Mortierella alpina (Oleaginous fungus) (Mortierella renispora)
Target Protein Sequence
MAELKSFTLADLSQHTTKDSLYLAIHGKVYDCTGFIDEHPGGEEVLIDEAGRDATESFED VGHSDEARDIMSKLLVGEFKTDSSEKPKAKSPSSSTPRPIPAAEPSDSGSLQYVLALAVV AGCVIWKVLL
Uniprot No.

Target Background

Function

Membrane-bound hemoprotein functioning as an electron carrier for various membrane-bound oxygenases.

Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

Basic Research Questions

  • What is the basic structure of Mortierella alpina cytochrome b5 and how does it compare to cytochrome b5 from other organisms?

    Mortierella alpina cytochrome b5 is a heme-containing protein with significant structural homology to cytochrome b5s from other organisms. The deduced amino acid sequence shows approximately 50% identity with Saccharomyces cerevisiae and 35% identity with mammalian cytochrome b5 sequences. The protein contains highly conserved heme-binding domains typical of cytochrome b5 proteins. Unlike mammalian cytochrome b5s which have a β-sheet structure connecting the FAD-binding and NADH-binding domains, both M. alpina and S. cerevisiae cytochrome b5s lack this structure, suggesting a more compact folding between the two domains .

    The genomic structure of M. alpina cytochrome b5 consists of four exons and three introns, with the introns following the GT-AG splicing rule. The gene exhibits a G+C content of 54.9% with a strong preference for C at the third position of codons .

  • How can researchers effectively express recombinant M. alpina cytochrome b5 in heterologous systems?

    For heterologous expression of M. alpina cytochrome b5, multiple expression systems have been successfully employed, each with different methodological considerations:

    • E. coli expression: The soluble form of the cytochrome b5 gene can be expressed to approximately 16% of the total soluble protein in E. coli, with the holo-cytochrome b5 accounting for 8% of the total cytochrome b5 in the transformants .

    • Aspergillus oryzae expression: Full-length cDNA can be cloned into a fungal expression vector (e.g., pNGA142) under the control of a strong promoter such as the glucoamylase gene (glaA) promoter. This system has achieved 4.7-fold higher ferricyanide reduction activity in transformed strains compared to control strains .

    When optimizing expression, researchers should:

    1. Modify the sequence around the start codon to CCACCATG for improved translation in eukaryotic hosts

    2. Verify correct protein folding through activity assays (e.g., ferricyanide reduction)

    3. Use appropriate purification methods such as DEAE-Sephacel, Mono-Q HR 5/5, and AMP-Sepharose 4B affinity chromatographies for a 645-fold increase in specific activity

  • What methods are used for purification and activity assessment of recombinant M. alpina cytochrome b5?

    Purification of recombinant M. alpina cytochrome b5 involves several sequential steps:

    1. Microsome preparation: Cells are disrupted and microsomes isolated by differential centrifugation

    2. Solubilization: Microsomes are solubilized using cholic acid sodium salt

    3. Chromatographic purification: A multi-step process involving:

      • DEAE-Sephacel ion exchange chromatography

      • Mono-Q HR 5/5 anion exchange chromatography

      • AMP-Sepharose 4B affinity chromatography

    Activity assessment typically employs the following methods:

    • NADH-ferricyanide reductase assay: Measures electron transfer capability with NADH as electron donor

    • DCPIP reduction assay: Can achieve specific activity of approximately 114 μmol/min/mg with NADH as electron donor

    • Spectral analysis: Purified cytochrome b5 exhibits characteristic oxidized and reduced absorbance spectra

    The purified enzyme shows a strong preference for NADH over NADPH as an electron donor, which is an important characteristic for verifying proper folding and functionality .

  • What is the role of cytochrome b5 in polyunsaturated fatty acid biosynthesis in M. alpina?

    Cytochrome b5 plays a crucial role in polyunsaturated fatty acid (PUFA) biosynthesis in M. alpina as a component of the microsomal electron transport system. It functions by:

    1. Facilitating electron transfer to various desaturases, particularly the Δ5 and Δ6 desaturases that are involved in the conversion of precursor fatty acids to arachidonic acid (ARA)

    2. Serving as an electron donor for the desaturation reactions that introduce carbon-carbon double bonds into fatty acid chains

    3. Supporting the Δ5 and Δ6 desaturases that contain cytochrome b5-like domains linked to their N-terminus

    The M. alpina Δ5 desaturase inserts a carbon-carbon double bond at the Δ5-position of dihomo-γ-linolenic acid (DGLA) to produce arachidonic acid, while the Δ6 desaturase converts linoleic acid to γ-linolenic acid in the ARA biosynthetic pathway. The efficient function of these desaturases relies on the electron transfer capabilities of cytochrome b5 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.