Recombinant Mortierella alpina Delta (5) fatty acid desaturase

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
DES1; Acyl-lipid; 8-3-desaturase; Delta(5 fatty acid desaturase; Delta-5 fatty acid desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-446
Protein Length
full length protein
Species
Mortierella alpina (Oleaginous fungus) (Mortierella renispora)
Target Names
DES1
Target Protein Sequence
MGTDQGKTFTWEELAAHNTKGDLFLAIRGRVYDVTKFLSRHPGGVDTLLLGAGRDVTPVF EMYHAFGAADAIMKKYYVGTLVSNELPVFPEPTVFHKTIKTRVEGYFTDRDIDPKNRPEI WGRYALIFGSLIASYYAQLFVPFVVERTWLQVVFAIIMGFACAQVGLNPLHDASHFSVTH NPTVWKILGATHDFFNGASYLVWMYQHMLGHHPYTNIAGADPDVSTFEPDVRRIKPNQKW FVNHINQDMFVPFLYGLLAFKVRIQDINILYFVKTNDAIRVNPISTWHTVMFWGGKAFFV WYRLIVPLQYLPLGKVLLLFTVADMVSSYWLALTFQANHVVEEVQWPLPDENGIIQKDWA AMQVETTQDYAHDSHLWTSITGSLNYQAVHHLFPNVSQHHYPDILAIIKNTCSEYKVPYL VKDTFWQAFASHLEHLRVLGLRPKEE
Uniprot No.

Target Background

Function

Recombinant Mortierella alpina Delta(5) fatty acid desaturase is a fatty acid desaturase that introduces a cis double bond at the 5-position in 20-carbon polyunsaturated fatty acids. These fatty acids are incorporated into glycerolipids containing a Delta(8) double bond. The enzyme is involved in the conversion of dihomo-γ-linolenic acid to arachidonic acid and plays a crucial role in eicosanoid biosynthesis.

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the function of Delta(5) fatty acid desaturase in Mortierella alpina?

Delta(5) fatty acid desaturase (D5D) in Mortierella alpina is a key enzyme in the polyunsaturated fatty acid (PUFA) biosynthetic pathway. It catalyzes the introduction of a double bond at the delta-5 position of dihomo-gamma-linolenic acid (DGLA, C20:3 Delta8,11,14) to produce arachidonic acid (ARA, C20:4 Delta5,8,11,14) . This conversion represents a critical step in the omega-6 fatty acid pathway. The enzyme contains conserved histidine-rich motifs typical of membrane-bound desaturases and exhibits a unique structural feature among fungal desaturases - an N-terminal domain related to cytochrome b5 .

How was the Delta(5) fatty acid desaturase gene first isolated from Mortierella alpina?

The Delta(5) fatty acid desaturase gene was first isolated from M. alpina using a PCR-based strategy. Researchers designed primers corresponding to conserved histidine box regions found in microsomal desaturases . The isolation process involved:

  • Amplification of M. alpina cDNA using oligonucleotide primers targeting conserved regions of known Delta(6) desaturase genes

  • Isolation of a DNA fragment with homology to Delta(6) desaturases from borage and cyanobacteria

  • Using this fragment as a probe to isolate a cDNA clone with an open reading frame encoding 446 amino acids from an M. alpina library

  • Functional confirmation by expression in Saccharomyces cerevisiae, followed by lipid analysis that demonstrated accumulation of arachidonic acid

This methodological approach enabled the identification of what was reported as the first example of a cloned Delta(5) desaturase .

What are the structural characteristics that distinguish M. alpina Delta(5) desaturase from other fungal desaturases?

The M. alpina Delta(5) desaturase possesses several distinguishing structural features:

  • It contains an N-terminal domain related to cytochrome b5, which is not typically found in other fungal desaturases previously characterized

  • The protein includes three conserved histidine-rich motifs that are essential for desaturase catalytic activity

  • It is classified as a typical membrane-bound desaturase based on its hydropathy profile

  • The enzyme is encoded by a cDNA with an open reading frame of 446 amino acids

These structural characteristics contribute to its specific function in the biosynthetic pathway of polyunsaturated fatty acids, particularly arachidonic acid production in M. alpina.

What expression systems have been successfully used for recombinant production of M. alpina Delta(5) desaturase?

Several expression systems have been successfully employed for the recombinant production of M. alpina Delta(5) desaturase:

  • Saccharomyces cerevisiae (Baker's yeast): The most commonly used system for initial functional characterization. Expression in S. cerevisiae has been achieved using inducible promoters, with the effects of growth and induction conditions being carefully evaluated to optimize Delta(5) desaturase activity .

  • Transgenic plants: The M. alpina Delta(5) desaturase has been expressed in transgenic canola seeds, resulting in the production of novel fatty acids including taxoleic acid (Delta5,9-18:2) and pinolenic acid (Delta5,9,12-18:3) . The enzyme has also been utilized in various plant engineering strategies involving multiple desaturases to increase polyunsaturated fatty acid content.

  • Aspergillus species: Heterologous expression in filamentous fungi like Aspergillus has been reported, enabling more efficient production of polyunsaturated fatty acids in fungal systems .

  • Mortierella alpina itself: Homologous overexpression in M. alpina using auxotrophic strains (such as CCFM 501) and appropriate selective markers (such as ura5) has been achieved through Agrobacterium tumefaciens-mediated transformation .

Each expression system offers distinct advantages depending on research objectives, with yeast systems providing rapid functional validation and plant/fungal systems enabling higher production levels for metabolic engineering applications.

What techniques are most effective for verifying successful transformation and expression of the recombinant Delta(5) desaturase gene?

Multiple complementary techniques are essential for verifying successful transformation and expression of recombinant Delta(5) desaturase:

Genomic Integration Verification:

  • PCR analysis using gene-specific primers to confirm the presence of the transgene in the host genome

  • Southern blot analysis to verify integration and determine copy number of the transgene

  • Selection on appropriate marker-free media for successive generations to ensure stable transformation

Expression Verification:

  • Quantitative PCR (qPCR) to measure transcription levels of the introduced Delta(5) desaturase gene

  • Western blot analysis using antibodies specific to the Delta(5) desaturase protein or to epitope tags incorporated into the recombinant protein

  • Northern blot analysis to detect mRNA expression levels

Functional Verification:

  • Fatty acid methyl ester (FAME) analysis using gas chromatography to quantify changes in fatty acid profiles, particularly the increase in arachidonic acid and decrease in dihomo-gamma-linolenic acid

  • Feeding studies with substrate fatty acids to confirm the specific desaturation activity

  • Lipid fractionation and analysis to determine the distribution of novel fatty acids in different lipid classes

A comprehensive verification approach employing multiple methods provides the most robust confirmation of successful recombinant expression and activity.

How can researchers optimize the heterologous expression of M. alpina Delta(5) desaturase in yeast systems?

Optimizing heterologous expression of M. alpina Delta(5) desaturase in yeast systems involves several critical parameters:

Promoter Selection and Induction Conditions:

  • Use of appropriate inducible promoters allows controlled expression

  • Systematic evaluation of induction timing, inducer concentration, and duration of induction period

  • The effects of growth and induction conditions significantly impact recombinant Delta(5) desaturase activity in S. cerevisiae

Host Strain Selection:

  • Evaluate multiple yeast strains as hosts for expression

  • Consider strains with modified lipid metabolism or deficiencies in competing pathways

  • The choice of host strain has been demonstrated to affect the activity of recombinant Delta(5) desaturase

Codon Optimization:

  • Adapt the coding sequence to the preferred codon usage of the yeast host

  • Eliminate rare codons that might limit translation efficiency

Substrate Availability:

  • Supplement growth media with appropriate fatty acid substrates (e.g., dihomo-gamma-linolenic acid)

  • Consider co-expression with elongases that can produce the substrate fatty acid

Culture Conditions:

  • Optimize temperature, pH, and aeration parameters

  • Investigate the impact of different carbon sources and nutrient compositions

  • Consider lower culture temperatures (below 30°C) which may improve membrane protein folding

Expression Construct Design:

  • Include appropriate signal sequences if needed for correct localization

  • Consider fusion tags that may enhance protein stability or facilitate purification

  • Explore modifications to the N-terminal cytochrome b5-like domain to optimize electron transport

Systematic optimization of these parameters through factorial experimental design can significantly improve recombinant Delta(5) desaturase production and activity in yeast expression systems.

How are Delta(5) desaturase-defective mutants of M. alpina created and what are their applications in research?

Delta(5) desaturase-defective mutants of M. alpina are created through several methodological approaches:

Chemical Mutagenesis:

  • Treatment of M. alpina spores with mutagens such as N-methyl-N′-nitro-N-nitrosoguanidine (MNNG)

  • Screening of surviving colonies for altered fatty acid profiles, particularly increased DGLA and decreased ARA levels

  • This approach was used to develop the novel Δ5-desaturase-defective mutant derived from M. alpina 1S-4

Random Insertional Mutagenesis:

  • Using transposons or other DNA elements to disrupt the Delta(5) desaturase gene

  • Selection of transformants with disrupted gene function

Targeted Gene Disruption/Deletion:

  • CRISPR-Cas9 or other precise gene editing techniques to specifically target the Delta(5) desaturase gene

  • Homologous recombination approaches to replace the functional gene with a disrupted version

The applications of these Delta(5) desaturase-defective mutants in research include:

  • DGLA Production: Mutants serve as efficient production platforms for dihomo-gamma-linolenic acid (DGLA). For example, a mutant strain produced 2.4 g of DGLA per liter (43.3% of total fatty acids) when grown at 28°C for 7 days in a 5-liter jar fermentor .

  • Pathway Elucidation: These mutants allow researchers to study the polyunsaturated fatty acid biosynthetic pathway by creating specific blocks that result in the accumulation of intermediates.

  • Genetic Complementation Studies: The mutants provide an excellent background for testing variant forms of Delta(5) desaturase through genetic complementation.

  • Metabolic Engineering: They serve as base strains for further engineering to produce specific fatty acid profiles.

  • Functional Genomics: Used to validate gene function through rescue experiments with the wild-type gene.

The demonstrated efficiency of these mutants in producing alternative fatty acids makes them valuable tools for both basic research and biotechnological applications.

What analytical techniques are most reliable for characterizing the fatty acid profiles of wild-type and Delta(5) desaturase-modified strains?

Several complementary analytical techniques provide reliable characterization of fatty acid profiles in wild-type and Delta(5) desaturase-modified strains:

Gas Chromatography with Flame Ionization Detection (GC-FID):

  • The gold standard for quantitative fatty acid analysis

  • Requires derivatization of fatty acids to fatty acid methyl esters (FAMEs)

  • Provides excellent quantification of total fatty acid composition

  • Data from this technique revealed that Delta(5) desaturase-defective mutants produced 2.4 g/L of DGLA (43.3% of total fatty acids) compared to only a trace amount (about 1%) of arachidonic acid

Gas Chromatography-Mass Spectrometry (GC-MS):

  • Combines separation with mass-based identification

  • Essential for confirming the identity of novel or unusual fatty acids

  • Allows detection of positional and geometric isomers

High-Performance Liquid Chromatography (HPLC):

  • Complementary to GC methods, especially for thermally labile fatty acids

  • Can be coupled with various detectors (UV, refractive index, evaporative light scattering)

  • Particularly useful for analysis of intact lipids

Liquid Chromatography-Mass Spectrometry (LC-MS):

  • Allows analysis of intact complex lipids without derivatization

  • Provides insights into the positional distribution of fatty acids in complex lipids

  • Essential for lipidomic profiling

Silver-Ion Chromatography:

  • Specialized technique that separates fatty acids based on degree of unsaturation

  • Excellent for resolving geometrical and positional isomers

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Provides structural information about fatty acids including double bond position

  • Non-destructive analysis that can be used for positional analysis

Lipid Class Fractionation:

  • Thin-layer chromatography (TLC) or solid-phase extraction (SPE) to separate lipid classes

  • Studies have shown that about 80 mol% of DGLA produced in Delta(5) desaturase-defective mutants was found in triacylglycerol , and more than 97 mol% was in the triglyceride fraction regardless of growth temperature (12 to 28°C)

A comprehensive analytical approach employing multiple techniques provides the most complete characterization of fatty acid profiles in both wild-type and genetically modified strains.

How do temperature and other cultivation conditions affect the activity of recombinant Delta(5) desaturase and fatty acid profiles?

Temperature and cultivation conditions significantly impact recombinant Delta(5) desaturase activity and resulting fatty acid profiles through multiple mechanisms:

Temperature Effects:

  • Lower cultivation temperatures generally increase the proportion of polyunsaturated fatty acids in M. alpina

  • Temperature-dependent changes in membrane fluidity trigger compensatory mechanisms including altered desaturase expression

  • In Delta(5) desaturase-defective mutants, the distribution of DGLA in the triglyceride fraction remains high (>97 mol%) regardless of growth temperature in the range of 12-28°C

Carbon Source:

  • The type and concentration of carbon source affect both growth and fatty acid biosynthesis

  • Glucose concentration and feeding strategy impact the expression and activity of fatty acid desaturases

  • Complex carbon sources can alter the fatty acid profile compared to simple sugars

Nitrogen Source:

  • Nitrogen limitation often triggers lipid accumulation

  • The type of nitrogen source affects the expression of desaturase genes

  • Nitrogen-to-carbon ratio is a critical parameter for optimizing polyunsaturated fatty acid production

Dissolved Oxygen:

  • Oxygen is a co-substrate for desaturase enzymes

  • Appropriate aeration is essential for optimal desaturase activity

  • Dissolved oxygen levels must be carefully controlled in bioreactor cultivation

pH:

  • pH affects enzyme activity and membrane properties

  • Optimal pH for recombinant Delta(5) desaturase activity may differ from that of native enzyme

Growth Phase:

  • Desaturase expression and activity vary throughout the growth cycle

  • Timing of induction for recombinant expression systems is critical

Media Supplementation:

  • Addition of precursor fatty acids can enhance the production of specific polyunsaturated fatty acids

  • Metal ions, particularly iron, are essential cofactors for desaturase activity

A systematic optimization of these parameters is essential for maximizing recombinant Delta(5) desaturase activity and achieving desired fatty acid profiles. For example, a Delta(5) desaturase-defective mutant cultured under optimal conditions for 6 days at 28°C in a 10-liter fermentor produced 3.2 g of DGLA per liter (123 mg/g of dry mycelia), accounting for 23.4% of total mycelial fatty acids .

How can genomic comparison methods be used to identify novel types of fatty acid synthases in Mortierella species?

Genomic comparison methods have revolutionized our understanding of fatty acid synthases (FAS) in Mortierella species, revealing previously unknown structural variants. The methodological approach includes:

Whole Genome Sequencing and Assembly:

  • High-quality genome assembly is essential for accurate FAS identification

  • Modern sequencing platforms (PacBio, Illumina) enable high-resolution genomic analysis

  • Two novel high-quality genomes with 55.32% of syntenic gene pairs for M. alpina CGMCC 20262 and M. schmuckeri CGMCC 20261 were assembled, spanning 28 scaffolds (40.22 Mb) and 25 scaffolds (49.24 Mb), respectively

Comparative Genomic Analysis:

  • Multiple genome alignment of different Mortierella species

  • Identification of conserved and divergent regions in FAS genes

  • A comprehensive genomic comparison of 19 strains in 10 species across three genera in Mortierellaceae revealed three distinct types of FAS

Protein Domain Prediction and Analysis:

  • Identification of functional domains in predicted FAS proteins

  • Comparison of domain architecture across species

Phylogenetic Analysis:

  • Construction of phylogenetic trees based on FAS sequences

  • Evolutionary analysis of FAS types across fungal lineages

Through these approaches, researchers discovered three distinct types of fatty acid synthase in Mortierellaceae:

  • Type I FAS: The previously known type, existing in 16 strains of eight species across three genera, consisting of a single unit with eight active sites

  • Type II FAS: A newly revealed type found only in M. antarctica KOD 1030, where the unit is separated into two subunits (α and β) comprised of three and five active sites, respectively

  • Type III FAS: Another newly revealed type in M. alpina AD071 and Dissophora globulifera REB-010B, similar to type II but with one additional acyl carrier protein domain in the α subunit

These findings demonstrate how genomic comparison methods can uncover novel enzymatic architectures that may have implications for the unique fatty acid production capabilities of different Mortierella species.

What strategies can be used to enhance arachidonic acid production through genetic engineering of Delta(5) desaturase?

Several sophisticated genetic engineering strategies can enhance arachidonic acid production through modification of Delta(5) desaturase:

Promoter Engineering:

  • Replacement of native promoters with stronger, constitutive, or inducible promoters

  • Design of synthetic promoters with enhanced activity

  • Integration of multiple copies of the Delta(5) desaturase gene under different promoters

Protein Engineering:

  • Site-directed mutagenesis to improve catalytic efficiency or substrate specificity

  • Creation of chimeric enzymes combining functional domains from different desaturases

  • Directed evolution approaches to select variants with enhanced activity

Pathway Engineering:

  • Overexpression of upstream genes (Delta(6) desaturase, elongases) to increase substrate availability

  • Downregulation of competing pathways through RNAi or CRISPR interference

  • Introduction of heterologous genes to create novel pathways

Cofactor Optimization:

  • Engineering electron transport systems that support desaturase function

  • Overexpression of cytochrome b5 or NADH-cytochrome b5 reductase

  • Modification of iron uptake systems to ensure adequate cofactor availability

Multi-gene Integration Strategies:

  • Development of multi-gene constructs with optimized gene arrangements

  • Use of bidirectional promoters for coordinated expression

  • Implementation of polycistronic expression systems

Genomic Integration Targeting:

  • Identification of genomic hot spots for high expression

  • Development of site-specific integration systems

  • Creation of artificial chromosomes for stable maintenance of large constructs

These approaches have shown significant results in enhancing ARA production. For example, when Delta(5) desaturase was overexpressed in Phaeodactylum tricornutum, EPA (which requires Delta(5) desaturase activity) showed an increase of 58% in engineered microalgae, while maintaining similar growth rates to wild type . Additionally, comparative genomic analysis revealed that differences in genes encoding Delta(5) desaturase and elongation of very long chain fatty acids protein likely contribute to the higher polyunsaturated fatty acid production observed in M. alpina CGMCC 20262 (45.57% ARA) compared to M. schmuckeri CGMCC 20261 (6.95% ARA) .

How do Delta(5) desaturase expression levels correlate with the accumulation of specific polyunsaturated fatty acids in different lipid fractions?

The correlation between Delta(5) desaturase expression levels and polyunsaturated fatty acid accumulation in different lipid fractions involves complex metabolic interactions:

Differential Accumulation Patterns:

  • Polyunsaturated fatty acids show non-uniform distribution across lipid classes

  • In wild-type M. alpina, arachidonic acid can accumulate to approximately 50% of total fatty acids

  • In Delta(5) desaturase-defective mutants, DGLA accumulates preferentially in specific lipid fractions, with about 80 mol% found in triacylglycerol

  • Phospholipid fractions often show higher levels of specific polyunsaturated fatty acids, with DGLA accounting for as much as 60% in phosphatidylcholine in Delta(5) desaturase-defective mutants

Expression Level Effects:

Temporal Dynamics:

  • Delta(5) desaturase expression varies throughout the growth cycle

  • The timing of fatty acid accumulation differs between neutral lipids and phospholipids

  • Late-stage cultivation often shows higher proportions of polyunsaturated fatty acids in storage lipids

Metabolic Regulation:

  • Feedback inhibition mechanisms may regulate desaturase expression and activity

  • Membrane fluidity requirements influence the incorporation of polyunsaturated fatty acids into phospholipids

  • Storage requirements drive the accumulation patterns in triacylglycerols

Subcellular Localization:

  • The subcellular localization of Delta(5) desaturase affects its access to substrates in different lipid pools

  • The enzyme's interaction with other membrane-bound proteins influences its activity in specific lipid environments

Understanding these complex relationships requires comprehensive lipidomic analysis combined with gene expression studies at different growth stages and under varying cultivation conditions. This knowledge is essential for developing effective strategies to engineer fatty acid profiles for specific applications.

What are the current methodological challenges in expressing fungal Delta(5) desaturase in plant systems for metabolic engineering?

Expressing fungal Delta(5) desaturase in plant systems presents several methodological challenges that researchers must address:

Codon Usage Optimization:

  • Fungal and plant codon preferences differ significantly

  • Optimization of the fungal gene sequence for plant expression is essential

  • Codon optimization must balance efficient translation with mRNA stability

Subcellular Targeting:

  • Proper subcellular localization is critical for desaturase function

  • Selection of appropriate transit peptides for targeting to the endoplasmic reticulum

  • Verification of correct localization through fusion with fluorescent proteins

Integration Event Variability:

  • Random integration leads to highly variable expression levels

  • Position effects significantly impact transgene expression

  • Only rare elite integration events achieve very high expression levels

  • From 39 transgenic strains analyzed in one study, the majority had SDA levels lower than 10%, with only one strain reaching 25.21% and another 23.45%

Co-expression of Multiple Genes:

  • Coordinating expression of multiple desaturases and elongases is challenging

  • When using multiple genes in a single T-DNA vector, the SDA content was generally lower than through crossing plants with individual constructs

  • Proper stoichiometry between pathway enzymes is difficult to achieve

Substrate Availability:

  • Ensuring adequate substrate availability in the appropriate subcellular compartment

  • Competition with endogenous enzymes for substrate fatty acids

  • Metabolic channeling considerations in complex lipid pathways

Tissue-Specific Expression:

  • Selection of appropriate promoters for seed-specific or other tissue-specific expression

  • Temporal regulation to coincide with periods of active lipid synthesis

  • Managing potential developmental effects of altered membrane composition

Host Compatibility Issues:

  • Functional differences between plant and fungal desaturase systems

  • Electron transport chain compatibility for desaturase activity

  • Post-translational modifications may differ between fungi and plants

Phenotypic Stability:

  • Maintaining stable expression across generations

  • Silencing of transgenes in subsequent generations

  • Environmental influences on transgene expression

These challenges explain why, despite numerous attempts, the frequency of obtaining high-producing transgenic plants remains low. For example, in transgenic canola plants transformed with Delta(5), Delta(6), and Delta(12) desaturases, the majority of events (52 out of 75) had a SDA content lower than 7%, with only one event exceeding 15% . Similar patterns were observed with other constructs, highlighting the technical difficulties in achieving consistent high-level expression of fungal desaturases in plant systems.

How does the Delta(5) desaturase from M. alpina compare structurally and functionally with Delta(5) desaturases from other organisms?

The Delta(5) desaturase from M. alpina exhibits distinct structural and functional characteristics when compared to those from other organisms:

Structural Comparisons:

FeatureM. alpina Delta(5)Mammalian Delta(5)Plant Delta(5)Other Fungal Delta(5)
Size446 amino acids ~440 amino acidsVariableVariable
N-terminal cytochrome b5 domainPresent PresentUsually absentOften absent
Histidine boxesThree conserved motifsThree conserved motifsThree conserved motifsThree conserved motifs
Membrane topologyMultiple transmembrane domainsMultiple transmembrane domainsMultiple transmembrane domainsMultiple transmembrane domains
Phylogenetic groupingClusters with other Mortierellaceae Distinct cladeUsually plant-specific cladeSpecies-dependent

Functional Comparisons:

CharacteristicM. alpina Delta(5)Mammalian Delta(5)Plant Delta(5)Other Fungal Delta(5)
Primary substrateDGLA (C20:3 Δ8,11,14)DGLA (C20:3 Δ8,11,14)VariousOften DGLA
Secondary substratesCan act on other C20 fatty acidsNarrow specificityOften broader specificityVariable
Temperature optimumActive at lower temperatures~37°CVariableSpecies-dependent
Expression regulationGrowth phase dependentHighly regulatedOften tissue-specificVariable
Subcellular localizationEndoplasmic reticulumEndoplasmic reticulumEndoplasmic reticulumTypically endoplasmic reticulum

Evolutionary Context:

  • The M. alpina Delta(5) desaturase shows high homology with Delta(5) fatty acid desaturases from both the marine diatom Thalassiosira pseudonana and another annotated Delta(5) fatty acid desaturase (PtD5p) from Phaeodactylum tricornutum

  • It also exhibits homology with Delta(5) fatty acid desaturases from protozoa including Trypanosoma and Leishmania and microalgae species including Chlamydomonas and Ostreococcus

  • Phylogenetic analysis places it in a distinct clade from mammalian and plant Delta(5) desaturases

Biotechnological Applications:

  • The M. alpina Delta(5) desaturase has been more widely used in biotechnological applications compared to many other Delta(5) desaturases

  • It has shown superior functionality in heterologous expression systems, particularly for metabolic engineering of polyunsaturated fatty acid production

  • Its activity in yeast and plant expression systems has been more extensively characterized than many other Delta(5) desaturases

These comparative analyses highlight the unique features of M. alpina Delta(5) desaturase that make it particularly valuable for biotechnological applications while providing insights into the evolutionary relationships between desaturases from different biological kingdoms.

What novel approaches are emerging for engineering Delta(5) desaturase specificity or activity?

Several cutting-edge approaches are emerging for engineering Delta(5) desaturase specificity and activity:

Structure-Function Relationship Mapping:

  • Applying site-directed mutagenesis to identify critical residues for substrate binding and catalysis

  • Creating systematic alanine scanning libraries to map functional domains

  • Using homology modeling to predict the impact of specific amino acid substitutions

Directed Evolution Strategies:

  • Implementing error-prone PCR to generate libraries of Delta(5) desaturase variants

  • Developing high-throughput screening methods to identify variants with enhanced activity or altered specificity

  • Applying DNA shuffling techniques to combine beneficial mutations from different variants

Protein Design and Semi-rational Approaches:

  • Utilizing computational protein design to predict beneficial mutations

  • Creating chimeric enzymes by swapping domains between different desaturases

  • Combining structural insights with evolutionary information to target specific regions for modification

Systems Biology Integration:

  • Employing metabolic flux analysis to identify bottlenecks in polyunsaturated fatty acid production

  • Using transcriptomics and proteomics to understand the regulatory network controlling desaturase expression

  • Developing genome-scale models to predict the systemic effects of Delta(5) desaturase modifications

Advanced Expression Systems:

  • Designing synthetic gene clusters with optimized spatial arrangement of pathway genes

  • Developing inducible expression systems with fine-tuned control over desaturase levels

  • Creating subcellular targeting strategies to optimize enzyme localization

CRISPR-Based Approaches:

  • Employing CRISPR-Cas9 for precise genomic integration of modified desaturases

  • Using base editors to introduce specific amino acid changes without double-strand breaks

  • Implementing CRISPR interference (CRISPRi) or activation (CRISPRa) to modulate expression levels

Synthetic Biology Frameworks:

  • Designing completely synthetic desaturase genes based on fundamental principles

  • Creating modular desaturase components that can be assembled in different configurations

  • Implementing genetic circuits to dynamically regulate desaturase expression in response to cellular conditions

These innovative approaches are expanding the toolbox for engineering Delta(5) desaturases with enhanced properties for research and biotechnological applications, moving beyond traditional methods to more sophisticated strategies that leverage advances in protein engineering and synthetic biology.

What are the most promising research directions for understanding the regulatory mechanisms controlling Delta(5) desaturase expression in M. alpina?

Several promising research directions are emerging for elucidating the regulatory mechanisms that control Delta(5) desaturase expression in M. alpina:

Transcriptional Regulation Analysis:

  • Identification and characterization of promoter elements controlling Delta(5) desaturase gene expression

  • Investigation of transcription factors that bind to these regulatory regions

  • Analysis of chromatin modifications and their impact on gene accessibility

  • Development of reporter systems to monitor promoter activity under various conditions

Post-transcriptional Regulation:

  • Study of mRNA stability and turnover rates under different growth conditions

  • Investigation of potential regulatory RNAs that may affect Delta(5) desaturase expression

  • Analysis of RNA-binding proteins that might modulate translation efficiency

  • Examination of alternative splicing events that could generate variant transcripts

Post-translational Modifications:

  • Identification of potential phosphorylation, acetylation, or other modifications that affect enzyme activity

  • Investigation of protein stability and turnover mechanisms

  • Analysis of protein-protein interactions that might regulate Delta(5) desaturase function

  • Study of subcellular trafficking mechanisms that control enzyme localization

Metabolic Feedback Regulation:

  • Investigation of how fatty acid intermediates and products regulate desaturase expression

  • Analysis of how membrane fluidity sensors might modulate desaturase activity

  • Examination of cross-talk between different lipid metabolic pathways

  • Study of how energy status and carbon flux affect desaturase expression

Environmental Response Mechanisms:

  • Detailed examination of temperature-responsive regulation of Delta(5) desaturase

  • Investigation of oxygen sensing and its impact on desaturase expression

  • Analysis of nutrient-responsive signaling pathways affecting lipid metabolism

  • Study of stress response mechanisms that modulate fatty acid desaturation

Comparative Genomics Approaches:

  • Comparative analysis of regulatory regions across different M. alpina strains with varying ARA production capabilities

  • Examination of Delta(5) desaturase regulation in closely related species

  • Investigation of how genomic context affects desaturase expression

  • Identification of regulatory elements through evolutionary conservation analysis

Systems Biology Integration:

  • Development of comprehensive regulatory networks encompassing transcriptional, post-transcriptional, and post-translational mechanisms

  • Modeling of dynamic responses to environmental changes

  • Integration of multi-omics data to identify key regulatory nodes

  • Prediction of metabolic engineering targets to enhance desaturase expression

These research directions will provide deeper insights into the complex regulatory mechanisms controlling Delta(5) desaturase expression and activity in M. alpina, potentially leading to more effective strategies for enhancing polyunsaturated fatty acid production through rational metabolic engineering approaches.

What are the key considerations for designing experiments to study recombinant M. alpina Delta(5) desaturase in different host systems?

Designing robust experiments to study recombinant M. alpina Delta(5) desaturase requires careful consideration of several key factors:

Expression System Selection:

  • Choose the appropriate host system based on research goals (functional characterization vs. production)

  • Consider the pros and cons of each system:

    • S. cerevisiae: Rapid results, well-characterized, but lower production

    • Aspergillus: Higher production, similar cellular environment to M. alpina

    • Plants: Complex but useful for specific applications

    • Homologous expression in M. alpina: Most native environment but more technically challenging

Vector Design:

  • Include appropriate selectable markers for the chosen host

  • Select promoters compatible with the host and desired expression level

  • Consider codon optimization for the host organism

  • Include appropriate targeting sequences if necessary

  • Add epitope tags for detection if they don't interfere with function

Controls and Validation:

  • Include empty vector controls and wild-type host controls

  • Consider expressing a well-characterized desaturase as a positive control

  • Validate protein expression using multiple methods (Western blot, activity assays)

  • Verify subcellular localization if relevant to the study

Substrate Availability:

  • Ensure adequate substrate (DGLA) is available in the host

  • Consider supplementing media with substrate fatty acids

  • Potentially co-express upstream pathway enzymes to generate substrate in situ

Analytical Methods:

  • Plan for comprehensive fatty acid analysis using appropriate methods (GC-FID, GC-MS)

  • Consider analyzing different lipid fractions separately (phospholipids, neutral lipids)

  • Include time-course sampling to capture dynamic changes

Optimization Parameters:

  • Design factorial experiments to optimize multiple parameters simultaneously

  • Consider temperature, induction conditions, media composition, and harvest time

  • Include replicates to ensure statistical significance

Data Analysis Planning:

  • Establish quantification methods for both protein expression and enzymatic activity

  • Plan appropriate statistical analyses for optimization experiments

  • Consider how to normalize data across different experiments

Documentation and Reporting:

  • Maintain detailed records of all experimental conditions

  • Document all modifications to published protocols

  • Ensure results reporting includes all relevant experimental parameters

By systematically addressing these considerations, researchers can design experiments that yield reliable, reproducible results about the function and regulation of recombinant M. alpina Delta(5) desaturase in various host systems.

How should researchers approach troubleshooting low activity or expression of recombinant Delta(5) desaturase?

A systematic troubleshooting approach is essential when encountering low activity or expression of recombinant Delta(5) desaturase:

Expression-Level Troubleshooting:

  • Verify Gene Sequence Integrity:

    • Sequence the expression construct to confirm the absence of mutations

    • Verify that the reading frame is correct with no premature stop codons

    • Check that all regulatory elements (promoters, terminators) are intact

  • Optimize Codon Usage:

    • Analyze codon adaptation index for the host organism

    • Redesign the sequence to eliminate rare codons while maintaining key structural elements

    • Consider the impact of mRNA secondary structures on translation efficiency

  • Evaluate Promoter Strength:

    • Test alternative promoters with different expression characteristics

    • Confirm promoter functionality in your specific experimental conditions

    • Consider inducible promoters if constitutive expression is problematic

  • Address Protein Stability:

    • Add stabilizing fusion tags that don't interfere with function

    • Test lower growth temperatures to improve protein folding

    • Consider co-expression of chaperones to aid proper folding

  • Examine mRNA Levels:

    • Perform RT-PCR or Northern blotting to verify transcription

    • Check for premature transcription termination

    • Evaluate mRNA stability and half-life

Activity-Level Troubleshooting:

  • Verify Protein Localization:

    • Confirm proper subcellular targeting using fluorescent protein fusions

    • Evaluate membrane integration for this membrane-bound enzyme

    • Consider the impact of fusion tags on localization

  • Ensure Substrate Availability:

    • Analyze the fatty acid profile of the host to confirm substrate presence

    • Supplement media with the appropriate substrate (DGLA)

    • Consider co-expressing enzymes that produce the substrate

  • Optimize Cofactor Availability:

    • Ensure adequate iron availability as a cofactor for desaturase activity

    • Consider supplementing media with electron transfer components

    • Evaluate co-expression of cytochrome b5 or NADH-cytochrome b5 reductase

  • Adjust Assay Conditions:

    • Optimize extraction and analytical methods for fatty acid detection

    • Test different growth conditions including temperature, pH, and aeration

    • Evaluate various induction protocols if using inducible systems

  • Consider Host Compatibility:

    • Evaluate alternative host strains or species

    • Assess the host's endogenous desaturase and elongase activities

    • Check for potential inhibitory metabolites in the host

Systematic Experimental Approach:

  • Start with the simplest hypothesis and most readily testable factors

  • Change only one variable at a time when possible

  • Include appropriate positive and negative controls in each experiment

  • Document all troubleshooting steps and results systematically

  • Consider consulting the literature for similar enzymes and their expression challenges

This methodical troubleshooting approach can help identify and address the specific factors limiting recombinant Delta(5) desaturase expression or activity in your experimental system.

What are the most important considerations for interpreting and reporting fatty acid composition data from studies involving recombinant Delta(5) desaturase?

Proper interpretation and reporting of fatty acid composition data from recombinant Delta(5) desaturase studies requires careful attention to several critical factors:

Analytical Methodology Considerations:

  • Method Documentation:

    • Provide detailed description of extraction methods, derivatization procedures, and analytical parameters

    • Specify the type of column, temperature program, and detection method used for GC analysis

    • Document internal standards and calibration procedures

  • Data Normalization:

    • Clearly state whether data is presented as weight percentage, molar percentage, or absolute concentration

    • Specify the denominator when reporting percentages (percentage of total fatty acids vs. specific lipid fractions)

    • When reporting yields, clearly indicate whether values represent volumetric productivity (g/L) or content (% of dry weight)

  • Statistical Analysis:

    • Include appropriate statistical methods for comparing fatty acid profiles

    • Report both mean values and measures of variability (standard deviation or standard error)

    • Specify the number of biological and technical replicates

Biological Context Interpretation:

  • Complete Fatty Acid Profiles:

    • Report comprehensive fatty acid profiles, not just the fatty acids of interest

    • Include major fatty acids (>1%) at minimum, as demonstrated in studies of Delta(5) desaturase-defective mutants

    • Consider reporting minor fatty acids that may indicate alternative pathways

  • Lipid Fraction Specificity:

    • Analyze and report fatty acid composition in different lipid fractions (phospholipids, neutral lipids) when relevant

    • Note distinctive distributions, such as DGLA accounting for 60% in phosphatidylcholine in Delta(5) desaturase-defective mutants

    • Report the distribution of target fatty acids across lipid classes (e.g., 80 mol% of DGLA in triacylglycerol)

  • Pathway Analysis:

    • Interpret changes in precursors and products to evaluate enzyme activity

    • Consider calculating conversion ratios (product/substrate) as indicators of desaturase efficiency

    • Assess impacts on competing pathways and unexpected fatty acid accumulation

Experimental Context Reporting:

  • Growth Conditions:

    • Document all cultivation parameters that may affect fatty acid composition

    • Include temperature, media composition, growth phase at harvest, and duration of cultivation

    • Report any supplementation with precursor fatty acids or other additives

  • Expression System Details:

    • Specify the host organism, strain, and relevant genotype

    • Document expression vector details including promoters and selectable markers

    • Report induction conditions for inducible systems

  • Control Comparisons:

    • Include appropriate negative controls (empty vector, wild-type host)

    • Provide fatty acid profiles of positive controls when available

    • Present side-by-side comparisons with wild-type M. alpina when relevant

  • Reproducibility Considerations:

    • Address biological variability across multiple experiments or transformants

    • Discuss the consistency of fatty acid patterns across different experimental runs

    • Note any selection procedures used to identify high-performing transformants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.