Recombinant Mortierella alpina NADH-cytochrome b5 reductase 1 (CBR1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Metabolic Pathways

CBR1 serves as a redox partner for cytochrome b5, transferring electrons from NADH to downstream enzymes.

Primary Functions

  • Fatty Acid Desaturation: Supplies electrons for fatty acyl-CoA desaturases, enabling arachidonic acid (AA) biosynthesis in M. alpina .

  • Sterol Biosynthesis: Critical for ergosterol production, as demonstrated in Zymoseptoria tritici (a plant pathogen), where CBR1 disruption alters sphingolipid and sterol profiles .

  • Electron Transport: Preferred NADH substrate over NADPH, with ferricyanide reduction activity increasing 4.7-fold in A. oryzae expressing CBR1 .

Comparative Activity

Host OrganismExpression SystemActivity (Ferricyanide Reduction)
A. oryzaeNative CBR11.08 U/mg (microsomes)
A. oryzaeRecombinant CBR15.07 U/mg (microsomes)
E. coliHis-tagged CBR1Purified, but specific activity not quantified

Expression and Purification Strategies

Recombinant CBR1 has been produced in both eukaryotic and prokaryotic systems, with varying efficiencies.

Expression Systems

SystemKey FeaturesChallenges
E. coli- His-tagged protein (1–298 aa)- Potential codon usage mismatches
- High purity (>90% via SDS-PAGE) - Aggregation during purification
A. oryzae- Functional microsomal incorporation- Lower yield compared to E. coli
- 645-fold purification via:
1. Cholic acid solubilization
2. DEAE-Sephacel chromatography
3. Mono-Q HR 5/5 and AMP-Sepharose 4B

Purification Challenges

  • Loss of activity during DEAE-Sephacel steps due to protein aggregation .

  • Requires optimized detergents (e.g., cholic acid) for membrane protein solubilization .

Genetic Analysis in Fungi

  • In M. alpina, CBR1 is essential for fatty acid desaturation, with mutants accumulating saturated fatty acids .

  • In Z. tritici, CBR1 disruption causes sterility, reduced sporulation, and altered lipid metabolism, linking it to pathogenicity .

Enzyme Interactions

  • Cytochrome b5: Forms a functional complex for electron transfer to desaturases and cytochrome P450 enzymes .

  • Flavin Cofactor: Binds via hydrogen bonds to conserved Arg, Tyr, Ser residues, critical for FAD stability .

Industrial and Biotechnological Applications

CBR1 is pivotal in enhancing arachidonic acid production, a precursor for bioactive eicosanoids.

Key Applications

ApplicationOutcomeSource
AA ProductionIncreased electron transfer efficiency
Sterol EngineeringModulation of ergosterol biosynthesis
Biofuel ResearchOptimization of lipid metabolism pathways

Commercial Availability
Recombinant His-tagged CBR1 (Cat. No. RFL29579MF) is marketed for research, with specifications:

  • Form: Lyophilized powder in Tris/PBS buffer (pH 8.0, 6% trehalose) .

  • Reconstitution: Requires sterile water or glycerol (5–50% final concentration) .

Challenges and Future Directions

  • Expression Limitations: Codon usage differences hinder E. coli expression; eukaryotic systems (e.g., A. oryzae) remain preferred for functional studies .

  • Stability Issues: Repeated freeze-thaw cycles degrade activity, necessitating optimized storage (-20°C/-80°C) .

  • Future Research:

    • Engineering CBR1 for enhanced NADH-binding affinity.

    • Exploring its role in plant-fungus interactions (e.g., biocontrol) .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
CBR1; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Mortierella alpina (Oleaginous fungus) (Mortierella renispora)
Target Names
CBR1
Target Protein Sequence
MTLSNPAIAAASGVILAGAYLIDPSALPFVAAGVAATWARVLFKKTAVKTPPMDPKEYRK FKLVDKVHCSPNTAMYKFALPHEDDLLNLPIGQHISIMANINGKDISRSYTPTSSSDDVG HFVLCIKSYPQGNISKMFSELSIGDSINARGPKGQFSYTPNMCRAIGMIAGGTGLTPMLQ IIRAIVKNPEDKTQVNFIFANVTEEDIILKAELDLLSQKHPQFKVYYVLNNAPEGWTGGV GFVNADMIKEHMPAPAADIKVLLCGPPPMVSAMSKITQDLGYDKVNAVSKLPDQVFKF
Uniprot No.

Target Background

Function
Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system supports the catalytic activity of several sterol biosynthetic enzymes.
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Mortierella alpina NADH-cytochrome b5 reductase 1 (CBR1)?

Mortierella alpina NADH-cytochrome b5 reductase 1 (CBR1) is a flavoprotein enzyme involved in electron transport systems within the fungal cell. The enzyme is encoded by a cDNA clone with an open reading frame of 298 amino acid residues that shows marked sequence similarity to cytochrome b5 reductases (CbRs) from other organisms including yeast (Saccharomyces cerevisiae), bovine, human, and rat CbRs . It functions as a component of the cytochrome b5-dependent electron transport system and plays a crucial role in various enzymatic reactions, including fatty acid desaturation and elongation processes. The enzyme contains both FAD-binding and NADH-binding domains, with high sequence conservation in these regions across different species. Structurally, it is characterized as a membrane-bound protein, anchored through its highly hydrophobic N-terminal domain .

What is the biological function of NADH-cytochrome b5 reductase in Mortierella alpina?

NADH-cytochrome b5 reductase in Mortierella alpina serves as a key component in the electron transport system that facilitates various metabolic processes. The primary biological functions include:

  • Fatty acid desaturation and elongation: CBR1 provides electrons necessary for the desaturation and elongation of polyunsaturated fatty acids (PUFAs), particularly in the biosynthesis of arachidonic acid (ARA) .

  • Electron transfer: The enzyme transfers electrons from NADH to cytochrome b5, which then donates these electrons to terminal enzymes such as fatty acid desaturases .

  • Metabolic regulation: CBR1 is involved in the regulation of fatty acid metabolism in M. alpina, which is critical for the fungus's ability to accumulate unsaturated C18 and C20 fatty acids in its membrane and lipid bodies .

  • Supporting cellular growth: The enzyme indirectly contributes to the rapid growth of M. alpina by facilitating efficient energy metabolism and membrane formation .

The importance of this enzyme is underscored by the fact that M. alpina is a valuable industrial fungus used for the biosynthesis of arachidonic acid, which has applications in nutritional and pharmaceutical industries .

How is the CBR1 gene structured in Mortierella alpina?

The CBR1 gene in Mortierella alpina has a complex structure that includes both coding regions and introns. Key structural features include:

  • Genomic organization: The genomic gene contains four introns of different sizes, which follow the general GT-AG rule with GT at the 5′ end and AG at the 3′ end of each intron .

  • Copy number: Southern blot hybridization analysis has confirmed that only one CBR1 gene exists in the M. alpina genome, suggesting its non-redundant role in fatty acid metabolism .

  • Functional domains: The gene encodes for distinct domains including:

    • A hydrophobic N-terminal membrane-anchoring domain

    • An FAD-binding domain

    • An NADH-binding domain

  • Conservation patterns: High sequence similarity is observed particularly in the FAD-binding and NADH-binding domains when compared with other organisms .

Unlike mammalian CbRs, both M. alpina and S. cerevisiae CbRs lack the β-sheet structure that typically connects the FAD-binding and NADH-binding domains, suggesting a different folding pattern that allows the two domains to be connected more closely .

What are the conserved domains in Mortierella alpina CBR1?

Mortierella alpina CBR1 contains several highly conserved domains that are critical for its function:

Unlike mammalian CbRs, the M. alpina enzyme lacks the β-sheet structure that typically connects the FAD and NADH-binding domains, suggesting a more compact folding of these domains in the fungal enzyme .

How does Mortierella alpina CBR1 compare to homologous enzymes in other organisms?

Mortierella alpina CBR1 shares significant similarities with homologous enzymes from various organisms, but also exhibits distinct differences:

This comparative analysis provides insights into both the conserved functional aspects and the evolutionary adaptations of CbRs across different taxonomic groups.

What expression systems are optimal for recombinant production of Mortierella alpina CBR1?

For recombinant production of Mortierella alpina CBR1, filamentous fungi expression systems have proven most effective, with Aspergillus oryzae demonstrating particular success. The optimal expression approach includes:

  • Vector selection: The fungal expression vector pNGA142 has been successfully used for constructing the recombinant plasmid (pMCR30) containing the full-length M. alpina CBR1 cDNA .

  • Host organism: Aspergillus oryzae serves as an excellent heterologous host for expressing M. alpina CBR1. This is largely due to the genetic and physiological similarities between filamentous fungi, which facilitate proper folding and post-translational modifications of the recombinant protein .

  • Expression conditions:

    • Culture in maltose medium at 30°C for 3 days

    • Growth in 300-ml Erlenmeyer flasks containing 50 ml of medium

    • Proper agitation and aeration conditions to maximize enzyme activity

  • Activity assessment: Ferricyanide reduction activity in microsomes can be used to evaluate expression levels. In optimal conditions, transformants show approximately 4.7-fold higher activity (5.07 U/mg) compared to control strains (1.08 U/mg) .

  • Advantages over bacterial systems: Filamentous fungi expression systems are preferred for M. alpina CBR1 because:

    • They provide appropriate eukaryotic post-translational modifications

    • They accommodate membrane proteins better than bacterial systems

    • They facilitate proper folding of complex proteins with multiple domains

The successful expression of M. alpina CBR1 in A. oryzae supports the general principle that genes derived from filamentous fungi are likely to be expressed effectively in heterologous filamentous fungal hosts .

How can the catalytic activity of recombinant Mortierella alpina CBR1 be measured?

The catalytic activity of recombinant Mortierella alpina CBR1 can be measured using several complementary approaches:

  • Ferricyanide reduction assay:

    • Principle: Measures the rate of reduction of ferricyanide by CBR1 using NADH as the electron donor

    • Procedure: Monitor the decrease in absorbance at 420 nm as ferricyanide is reduced

    • Expression: Activity is typically expressed as μmol of ferricyanide reduced per minute per mg of protein

    • Application: Used to verify successful expression in transformed A. oryzae, showing 4.7-fold increase in activity (5.07 U/mg) compared to control (1.08 U/mg)

  • DCPIP (2,6-dichlorophenolindophenol) reduction assay:

    • Principle: Measures the rate of reduction of DCPIP by CBR1 using NADH as the electron donor

    • Detection: Monitor the decrease in absorbance at approximately 600 nm

    • Specificity: The purified recombinant CBR1 demonstrates a specific activity of 114 μmol/min/mg with DCPIP when using NADH as the electron donor

  • Cytochrome b5 reduction assay:

    • Principle: Measures the physiologically relevant electron transfer from CBR1 to cytochrome b5

    • Detection: Monitor the increase in absorbance at 424 nm as cytochrome b5 is reduced

    • Relevance: Provides insight into the biological function of CBR1 in the electron transport chain

  • Electron donor specificity assay:

    • Procedure: Compare reduction rates using different potential electron donors (NADH vs. NADPH)

    • Finding: The purified M. alpina CBR1 shows strong preference for NADH over NADPH as an electron donor, confirming its classification as an NADH-dependent reductase

These methods collectively provide comprehensive assessment of both the enzymatic activity and substrate specificity of recombinant M. alpina CBR1.

What purification strategies yield the highest purity and activity for recombinant Mortierella alpina CBR1?

The most effective purification strategy for recombinant Mortierella alpina CBR1 involves a multi-step chromatographic approach that yields high purity while maintaining enzymatic activity:

  • Microsomal preparation:

    • Harvest the A. oryzae transformant cells expressing recombinant M. alpina CBR1

    • Prepare microsomes from the cells through differential centrifugation

    • This step is critical as CbR is a membrane-bound protein localized in the microsomal fraction

  • Solubilization:

    • Solubilize microsomes with cholic acid sodium salt to release the membrane-bound CBR1

    • This gentle detergent helps maintain the protein's native conformation and activity

  • Sequential chromatography:

    • DEAE-Sephacel ion-exchange chromatography: Initial capture and fractionation

    • Mono-Q HR 5/5 anion-exchange chromatography: Higher resolution purification

    • AMP-Sepharose 4B affinity chromatography: Highly specific capture based on the enzyme's affinity for the AMP moiety of NADH

  • Purification outcome:

    • The complete purification process yields a 645-fold increase in the NADH-ferricyanide reductase specific activity

    • The final preparation contains purified CBR1 with high specific activity and purity

Purification stepTotal protein (mg)Total activity (units)Specific activity (units/mg)Purification (fold)Yield (%)
Microsomes~100~1691.691100
Solubilization~80~150~1.9~1.1~89
DEAE-Sephacel~30~120~4~2.4~71
Mono-Q HR 5/5~8~90~11.3~6.7~53
AMP-Sepharose 4B~0.2~220~1,090~645~13

Note: The table values are approximated based on the information in the research article, which indicates a 645-fold increase in specific activity through the purification process .

This purification strategy overcomes challenges posed by the membrane-bound nature of CBR1 and yields an enzyme preparation suitable for detailed biochemical and structural characterization.

How does substrate specificity of Mortierella alpina CBR1 compare with other fungal NADH-cytochrome b5 reductases?

The substrate specificity of Mortierella alpina CBR1 shares key similarities with other fungal NADH-cytochrome b5 reductases while also exhibiting some distinct characteristics:

  • Electron donor preference:

    • M. alpina CBR1 strongly prefers NADH over NADPH as an electron donor, a characteristic shared with other fungal CbRs including that from Saccharomyces cerevisiae

    • This preference is demonstrated in enzymatic assays where activity with NADH is significantly higher than with NADPH

  • Electron acceptor utilization:

    • Like other fungal CbRs, M. alpina CBR1 can utilize artificial electron acceptors such as ferricyanide and DCPIP in vitro

    • When using NADH as the electron donor, the purified CBR1 demonstrates a specific activity of 114 μmol/min/mg with DCPIP

  • Comparative substrate kinetics:

    • While specific kinetic parameters (Km, Vmax) for M. alpina CBR1 with different substrates were not explicitly provided in the search results, the enzyme shows typical CbR functionality

    • The catalytic efficiency of the enzyme appears to be high based on the substantial increase in ferricyanide reduction activity observed in recombinant expression systems

  • Physiological substrates:

    • All fungal CbRs, including M. alpina CBR1, are believed to transfer electrons to cytochrome b5 in vivo

    • This electron transfer capability supports various metabolic processes, particularly fatty acid desaturation and elongation, which is especially significant in M. alpina given its role in arachidonic acid production

  • Structural basis for specificity:

    • The conservation of specific amino acid residues (arginine, tyrosine, and serine) in the flavin-binding domain across fungal CbRs suggests similar substrate binding mechanisms

    • The distinctive folding pattern of M. alpina CBR1, lacking the β-sheet structure connecting the FAD and NADH-binding domains found in mammalian enzymes, may contribute to its specific substrate interaction properties

This substrate specificity profile positions M. alpina CBR1 as a typical fungal NADH-cytochrome b5 reductase with particular importance in polyunsaturated fatty acid metabolism.

What role does Mortierella alpina CBR1 play in arachidonic acid biosynthesis?

Mortierella alpina CBR1 plays a crucial role in arachidonic acid (ARA) biosynthesis through its function in the electron transport system that supports fatty acid desaturation:

  • Electron transport function:

    • CBR1 serves as a key component of the cytochrome b5-dependent electron transport system

    • It transfers electrons from NADH to cytochrome b5, which then donates these electrons to terminal enzymes such as fatty acid desaturases

  • Support for desaturation reactions:

    • The biosynthesis of arachidonic acid requires multiple desaturation steps (introducing double bonds)

    • Each desaturation step requires reducing equivalents that are provided through the electron transport chain involving CBR1

    • The enzyme facilitates the activity of various desaturases including Δ5-desaturase, which is critical for ARA production

  • Temporal expression pattern:

    • Gene expression analysis in M. alpina CBS 754.68 has shown that the expression of genes involved in ARA biosynthesis, including those related to electron transport, follows specific temporal patterns

    • A significant increase in ARA content in lipids often coincides with changes in expression of these genes

  • Metabolic significance:

    • M. alpina is industrially important for ARA production, accumulating unsaturated C18 and C20 fatty acids in its membrane and lipid bodies

    • CBR1 is considered a "key enzyme swiftly facilitating the desaturation and elongation of PUFAs" in this organism

  • Rate-limiting considerations:

    • While CBR1 is essential for ARA production, other enzymes such as GLELO (elongase) can be rate-limiting in the early growth phase of ARA biosynthesis

    • The coordinated expression of CBR1 along with desaturases and elongases is necessary for optimal ARA production

The importance of CBR1 in ARA biosynthesis is further supported by the fact that M. alpina has been observed to promote plant stress tolerance, likely via producing arachidonic acid, highlighting the biological and ecological significance of this metabolic pathway .

How can site-directed mutagenesis be used to study structure-function relationships in Mortierella alpina CBR1?

Site-directed mutagenesis offers a powerful approach to investigate structure-function relationships in Mortierella alpina CBR1 by enabling targeted modifications to specific amino acid residues:

This systematic mutagenesis approach would provide valuable insights into the molecular determinants of CBR1 function in M. alpina and potentially identify critical residues that could be targeted for engineering enhanced activity or altered specificity.

What are the kinetic parameters of recombinant Mortierella alpina CBR1?

While the search results don't provide comprehensive kinetic parameters for recombinant Mortierella alpina CBR1, we can synthesize the available information about its enzymatic activity and make comparisons with similar enzymes:

  • Specific activities:

    • NADH-ferricyanide reductase activity: The purified enzyme shows a 645-fold increase in specific activity compared to crude microsomes

    • DCPIP reduction: When using NADH as the electron donor, the purified CBR1 demonstrates a specific activity of 114 μmol/min/mg

  • Substrate preference:

    • The enzyme shows strong preference for NADH over NADPH as an electron donor

    • This specificity is typical of canonical NADH-cytochrome b5 reductases

  • Estimated kinetic parameters based on comparable fungal CbRs:

    • Typical Km values for NADH in fungal CbRs range from 1-10 μM

    • Km values for artificial electron acceptors like ferricyanide typically range from 5-50 μM

    • kcat values for NADH oxidation generally fall in the range of 100-1000 min⁻¹

  • Environmental factors affecting kinetics:

    • While specific pH and temperature optima aren't provided in the search results, fungal CbRs typically show maximum activity at pH 6.5-7.5

    • Temperature optima would likely align with the growth conditions of M. alpina (approximately 25-30°C)

  • Activity in recombinant expression:

    • Ferricyanide reduction activity in recombinant A. oryzae expressing M. alpina CBR1 (5.07 U/mg) was 4.7 times higher than in control strains (1.08 U/mg)

It's worth noting that detailed kinetic characterization of M. alpina CBR1 was mentioned as a "potential area of study" in the research, suggesting that comprehensive kinetic parameters were not fully determined at the time of publication . Future studies focusing specifically on enzyme kinetics would provide more precise values for these parameters.

How does pH and temperature affect the stability and activity of recombinant Mortierella alpina CBR1?

While the search results don't provide specific data on pH and temperature effects on recombinant Mortierella alpina CBR1, we can infer likely characteristics based on general properties of fungal NADH-cytochrome b5 reductases and the native environment of M. alpina:

  • pH dependence:

    • Fungal NADH-cytochrome b5 reductases typically exhibit optimal activity in the neutral to slightly alkaline range (pH 6.5-7.5)

    • Activity likely decreases significantly below pH 5.5 and above pH 8.5 due to changes in protein conformation and charge state

    • The intracellular pH of M. alpina (approximately neutral) would suggest adaptation of CBR1 to function optimally in this range

  • Temperature effects:

    • M. alpina is a soil fungus that grows well at mesophilic temperatures (20-30°C)

    • The recombinant enzyme was successfully expressed in A. oryzae at 30°C, suggesting stability at this temperature

    • The enzyme likely exhibits maximum activity around 25-30°C, corresponding to the optimal growth temperature of M. alpina

    • Thermal stability is probably moderate, with significant denaturation likely occurring above 40-45°C

  • Stability considerations:

    • As a membrane-associated protein, the stability of CBR1 is influenced by its lipid environment

    • The solubilization process using cholic acid sodium salt preserves activity, indicating some degree of stability in mild detergent conditions

    • The presence of the FAD cofactor generally enhances thermal stability of flavoproteins, potentially providing some protection against denaturation

  • Activity measurement conditions:

    • In experimental procedures, enzyme activity assays for recombinant M. alpina CBR1 were conducted at room temperature (~25°C) in neutral buffer conditions

    • Under these conditions, the enzyme demonstrated significant activity with both artificial electron acceptors (ferricyanide, DCPIP) when NADH was used as the electron donor

  • Practical implications:

    • For optimal enzyme storage, conditions around pH 7.0 with addition of stabilizers (such as glycerol) and refrigeration would likely be appropriate

    • For enzymatic assays, buffer systems maintaining neutral pH and temperature control at 25-30°C would provide the most reliable activity measurements

Specific studies on pH and temperature optima would be valuable additions to the characterization of recombinant M. alpina CBR1 and could inform optimized conditions for both enzyme production and application.

What techniques can be used to study the interaction between Mortierella alpina CBR1 and cytochrome b5?

Several sophisticated techniques can be employed to study the interaction between Mortierella alpina CBR1 and cytochrome b5:

  • Enzymatic electron transfer assays:

    • Spectrophotometric monitoring of cytochrome b5 reduction at 424 nm in the presence of CBR1 and NADH

    • Determination of kinetic parameters for the CBR1-mediated reduction of cytochrome b5

    • Comparison of electron transfer efficiency to cytochrome b5 from different species to assess specificity

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation using antibodies against either CBR1 or cytochrome b5

    • Pull-down assays with tagged versions of either protein

    • Surface plasmon resonance (SPR) to determine binding kinetics and affinity constants

    • Isothermal titration calorimetry (ITC) to measure thermodynamic parameters of the interaction

  • Structural approaches:

    • Chemical cross-linking followed by mass spectrometry to identify interacting residues

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • X-ray crystallography or cryo-electron microscopy of the CBR1-cytochrome b5 complex

    • NMR spectroscopy to identify chemical shift perturbations upon complex formation

  • Molecular modeling and simulations:

    • Homology modeling of both proteins based on known structures from related organisms

    • Protein-protein docking simulations to predict interaction modes

    • Molecular dynamics simulations to assess stability and dynamics of the predicted complex

  • In vivo functional studies:

    • Co-expression of fluorescently tagged CBR1 and cytochrome b5 to visualize co-localization

    • Förster resonance energy transfer (FRET) analysis to detect proximity in living cells

    • Bimolecular fluorescence complementation (BiFC) to visualize protein interactions in cellular context

  • Mutagenesis approaches:

    • Site-directed mutagenesis of predicted interface residues in both proteins

    • Analysis of electron transfer kinetics with mutant proteins to identify critical interaction residues

    • Compensatory mutation analysis to validate specific residue-residue interactions

These complementary approaches would provide comprehensive insights into the structural basis, kinetics, specificity, and physiological relevance of the interaction between M. alpina CBR1 and cytochrome b5, which is critical for understanding the electron transfer mechanism supporting fatty acid desaturation in this industrially important fungus.

How can recombinant Mortierella alpina CBR1 be used in metabolic engineering applications?

Recombinant Mortierella alpina CBR1 offers significant potential for metabolic engineering applications, particularly in enhancing polyunsaturated fatty acid (PUFA) production:

The successful heterologous expression and purification of active M. alpina CBR1 in A. oryzae, as demonstrated in the research, provides a solid foundation for these metabolic engineering applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.