Recombinant Mortierella alpina Palmitoyltransferase AKR1

Shipped with Ice Packs
In Stock

Description

Introduction to Mortierella alpina and Palmitoyltransferase AKR1

Mortierella alpina is an oleaginous fungus primarily found in soil of temperate and cool regions, recognized for its exceptional capacity to produce long-chain polyunsaturated fatty acids (PUFAs) . The organism has distinct advantages in PUFA production and is notably the only source for dietary arachidonic acid (ARA) certified by the FDA and European Commission . Within this organism, Palmitoyltransferase AKR1 plays a crucial role in lipid metabolism.

Palmitoyltransferase AKR1 belongs to a class of enzymes known as acyltransferases (EC 2.3.1.-) that catalyze the transfer of acyl groups to substrate molecules . The protein contains ankyrin repeat domains, as indicated by its alternative name "Ankyrin repeat-containing protein AKR1" . These structural elements are likely involved in protein-protein interactions that are essential for the enzyme's biological function within the cellular environment of Mortierella alpina.

Protein Structure

The recombinant full-length Mortierella alpina Palmitoyltransferase AKR1 protein consists of 559 amino acids, typically produced with an N-terminal His tag to facilitate purification and detection . The protein's UniProt identification number is Q9UVH3, providing researchers with a standardized reference for this specific protein .

Physical Properties

The recombinant protein is typically produced as a lyophilized powder with a purity greater than 85-90% as determined by SDS-PAGE analysis . The molecular weight and isoelectric point can be calculated from the amino acid sequence, providing researchers with essential information for experimental design and interpretation.

Expression Systems

Recombinant Mortierella alpina Palmitoyltransferase AKR1 is predominantly expressed in Escherichia coli, though other expression systems including yeast, baculovirus, mammalian cells, and cell-free expression systems are also utilized depending on specific research requirements . E. coli remains the most common host due to its relative simplicity, cost-effectiveness, and high protein yield.

Purification and Tags

The protein is typically fused with an N-terminal His tag to facilitate purification through affinity chromatography . This tag allows for single-step purification using metal affinity resins, resulting in high purity isolates suitable for downstream applications. The following table summarizes the key production specifications:

ParameterSpecification
Expression HostE. coli (primary), Yeast, Baculovirus, Mammalian cells
TagHis (N-terminal)
Protein LengthFull Length (1-559 amino acids)
FormLyophilized powder
Purity>85-90% by SDS-PAGE

Quality Control

Quality control measures typically include SDS-PAGE analysis to confirm purity levels greater than 85-90% . Additional characterization may involve mass spectrometry for precise molecular weight determination and functional assays to confirm enzymatic activity.

Reconstitution Guidelines

Before opening, vials containing the lyophilized protein should be briefly centrifuged to ensure all material is at the bottom of the container . Reconstitution is recommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it may compromise protein integrity .

Buffer Composition

The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . Alternatively, some preparations use Tris-based buffer with 50% glycerol optimized for this specific protein . These formulations are designed to maintain protein stability during storage and subsequent handling.

Role in Lipid Metabolism

Mortierella alpina is renowned for its capacity to produce valuable long-chain polyunsaturated fatty acids, particularly arachidonic acid . While the specific role of Palmitoyltransferase AKR1 in this organism has not been fully characterized in the provided search results, acyltransferases generally play critical roles in lipid biosynthesis and modification.

Research Applications

The recombinant protein serves as a valuable tool for studying:

  1. Enzymatic mechanisms of palmitoyltransferases

  2. Structure-function relationships in acyltransferases

  3. Lipid metabolism in oleaginous fungi

  4. Comparative biochemistry across different organisms

Biotechnological Potential

Given Mortierella alpina's importance in producing commercially valuable fatty acids, understanding the function and regulation of enzymes like Palmitoyltransferase AKR1 could potentially contribute to metabolic engineering efforts aimed at enhancing production of specific lipids . Current research focuses on improving lipid yield and fatty acid desaturation by manipulating various aspects of the lipid biosynthesis pathway .

Functional Characterization

While the structural properties of Recombinant Mortierella alpina Palmitoyltransferase AKR1 are well-documented, further research is needed to fully elucidate its specific biochemical functions, substrate preferences, and regulation mechanisms. Determining the three-dimensional structure would significantly advance understanding of its catalytic mechanism.

Integration with Multi-omics Approaches

Current research trends in Mortierella alpina involve multi-omics studies to understand the global regulatory mechanisms of lipogenesis . Incorporating the study of Palmitoyltransferase AKR1 within this broader context could reveal important insights into how this enzyme interacts with other components of lipid metabolism pathways.

Biotechnological Applications

As research into Mortierella alpina continues to advance, particularly in areas of strain breeding and metabolic engineering, enzymes like Palmitoyltransferase AKR1 may become targets for manipulation to enhance lipid production or modify fatty acid profiles . This could have significant implications for industrial applications, including the production of nutritional supplements and specialty lipids.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Palmitoyltransferase AKR1; Ankyrin repeat-containing protein AKR1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-559
Protein Length
full length protein
Species
Mortierella alpina (Oleaginous fungus) (Mortierella renispora)
Target Protein Sequence
DPMLQDSQGFNALHLATHSSNAMLVLYLLMAGEMPVDTADTLGHTSLMWAAYQGDSLSVQ ILLKHGARVDTKDREGFTPLHWAVVKGNRECLSKILMAGADIKAGDKSGKTPVDMIKELK GTMIWDKALSDAKLSSDGQTRRTPFDKLMVLFPWYIALPLAVAQFLFGHIGAIKFLLRTR TPNDMLQTPYYTAVFQSTAFWVGFVWLRYLLGNTSHLLWMNIAFFVGYTSALYFFYGAVM ADPGWTKANSSYESQREAVVQMADRGLLDARHFCVSCIAQRPLRSKHCKFCNRCVAKFDH HCPWIYNCIGAKNHRAFLIFLALFLSSVPIYAYLSFEYLHVLSPSYVPVSSDPCLLGDTL CGYFQYDAFTTTLAFWSLFQMTWPGLLFLVQLYQVGQAKTTNEAMNFQRHSYLGKSMTIR QRILRSLTEIDSEMAGAGHPLQEESINLLEANGTATNDEDEVTLFAQEESKPVGFGDHEG HNHGARRAGGGGMWNLLVGTARRRRQQGEDRDVNPFDFGLWQNCVGFWSDGTQGPMRGVN WYSFYEAEARGGAATSRRM
Uniprot No.

Target Background

Function
Palmitoyltransferase specific for casein kinase 1.
Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Subcellular Location
Early endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Mortierella alpina Palmitoyltransferase AKR1?

Mortierella alpina Palmitoyltransferase AKR1 is an enzyme (EC 2.3.1.-) also known as Ankyrin repeat-containing protein AKR1. It is a full-length protein consisting of 559 amino acids derived from the oleaginous fungus Mortierella alpina (also referred to as Mortierella renispora) . This enzyme belongs to the transferase family that forms carbon-sulfur bonds, specifically functioning as an acyltransferase. The protein contains characteristic ankyrin repeat domains which typically mediate protein-protein interactions and are commonly found in proteins involved in diverse cellular functions including signal transduction and metabolism .

Mortierella alpina itself is a zygomycete known for its ability to accumulate lipids up to 50% of its dry weight in the form of triacylglycerols and is industrially important for the production of polyunsaturated fatty acids (PUFAs), particularly arachidonic acid (ARA) . Within this metabolic context, the AKR1 protein likely plays a role in lipid metabolism pathways.

How is Recombinant Mortierella alpina Palmitoyltransferase AKR1 typically expressed and purified?

Recombinant Mortierella alpina Palmitoyltransferase AKR1 is typically expressed in E. coli expression systems. Commercial preparations often include an N-terminal His-tag to facilitate purification . The expression vector contains the complete coding sequence (residues 1-559) of the protein under the control of a strong promoter suitable for bacterial expression .

For purification, standard affinity chromatography techniques using Ni-NTA or similar matrices are employed to isolate the His-tagged protein. After initial purification, additional chromatographic steps may be necessary to achieve high purity. The purified protein is typically provided in a lyophilized form or in a stabilizing buffer containing 50% glycerol .

For researchers preparing their own recombinant protein, optimizing expression conditions (temperature, IPTG concentration, induction time) is crucial for maximizing yield while maintaining proper folding. Given the presence of potential transmembrane domains, careful consideration of solubilization and refolding strategies may be necessary to obtain functionally active protein.

What is the presumed role of Palmitoyltransferase AKR1 in PUFA biosynthesis in Mortierella alpina?

While the specific role of Palmitoyltransferase AKR1 in PUFA biosynthesis is not explicitly detailed in the provided literature, we can contextualize its function within the known metabolic framework of Mortierella alpina. As a palmitoyltransferase, AKR1 likely participates in the transfer of palmitoyl groups to substrate molecules, potentially playing a role in the complex lipid synthesis pathways leading to PUFA production .

Mortierella alpina is known for its elaborate PUFA synthesis pathway, particularly for arachidonic acid (ARA) production. This pathway involves sequential desaturase and elongase-catalyzed steps starting from acetyl-CoA precursors . The genome-scale metabolic model of M. alpina has identified key components in this pathway, including the critical role of NADPH and acetyl-CoA availability .

Palmitoyltransferases often participate in protein modifications that affect membrane targeting or protein-protein interactions. Given the membrane-associated nature of fatty acid synthesis and modification enzymes, AKR1 may be involved in regulating the localization or activity of proteins involved in PUFA biosynthesis through palmitoylation .

What experimental approaches are recommended for assessing Palmitoyltransferase AKR1 activity in vitro?

For assessing the enzymatic activity of Palmitoyltransferase AKR1 in vitro, several complementary approaches are recommended:

  • Radioactive Labeling Assay: Using 3H or 14C-labeled palmitoyl-CoA as a substrate and monitoring the transfer of the labeled palmitoyl group to potential acceptor substrates. This approach provides high sensitivity but requires specialized facilities for handling radioactive materials.

  • Click Chemistry-Based Assays: Utilizing alkyne or azide-modified palmitoyl-CoA analogs that can be conjugated to fluorescent reporters after the transfer reaction, allowing non-radioactive detection of palmitoyltransferase activity.

  • HPLC or LC-MS Analysis: Quantifying the conversion of substrates to products using chromatographic separation coupled with appropriate detection methods. This approach is particularly valuable for identifying the specific molecular species modified by AKR1.

  • Coupled Enzyme Assays: Designing assays that link the palmitoyltransferase activity to other enzymatic reactions that produce measurable signals, such as fluorescence or absorbance changes.

When conducting these assays, researchers should carefully consider the following parameters to ensure reliable results:

  • Optimal pH and buffer conditions

  • Appropriate detergent concentration for enzyme solubilization

  • Metal ion requirements (potential cofactors)

  • Substrate concentration range for determining kinetic parameters

  • Temperature and reaction time optimization

How can researchers optimize expression conditions to improve yield and activity of recombinant AKR1?

Optimizing expression of Recombinant Mortierella alpina Palmitoyltransferase AKR1 requires a systematic approach addressing multiple factors that affect protein yield and activity:

  • Expression System Selection:

    • While E. coli is commonly used , consider alternative expression systems like yeast or insect cells for membrane-associated proteins that may require eukaryotic post-translational modifications.

    • Evaluate different E. coli strains designed for membrane protein expression (C41, C43) or strains with additional tRNAs for rare codons.

  • Expression Vector Optimization:

    • Select appropriate promoters (T7, tac) based on desired expression level.

    • Optimize codon usage for the expression host.

    • Test different fusion tags beyond His-tag (MBP, SUMO) that may improve solubility.

  • Culture Conditions:

    • Temperature: Lower temperatures (16-20°C) often improve proper folding of complex proteins.

    • Induction timing: Induce at optimal cell density (typically mid-log phase).

    • Inducer concentration: Titrate IPTG concentration (typically 0.1-1.0 mM) to find optimal level.

    • Media composition: Rich media (TB, 2YT) versus minimal media, depending on the specific requirements.

  • Extraction and Purification:

    • For membrane-associated proteins like AKR1, test various detergents for solubilization.

    • Optimize lysis conditions (sonication, pressure-based lysis, enzymatic lysis).

    • Implement a multi-step purification strategy to achieve high purity.

  • Refolding Strategies (if expressed as inclusion bodies):

    • Gradient dialysis to slowly remove denaturants.

    • On-column refolding during purification.

    • Rapid dilution methods to minimize aggregation during refolding.

After expression, perform activity assays to confirm functionality, as high yield does not necessarily correlate with properly folded, active enzyme.

What are the recommended storage conditions for maintaining stability of Recombinant Mortierella alpina Palmitoyltransferase AKR1?

Based on manufacturer recommendations, the following storage conditions should be implemented to maintain optimal stability of Recombinant Mortierella alpina Palmitoyltransferase AKR1:

Long-term Storage:

  • Store at -20°C or -80°C for extended periods .

  • The protein is typically provided in a stabilizing buffer containing Tris-based components and 50% glycerol .

  • For lyophilized preparations, ensure storage in a desiccated environment to prevent moisture absorption .

Working Stock Handling:

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce enzyme activity .

  • Working aliquots can be stored at 4°C for up to one week .

  • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Addition of 5-50% glycerol to the final solution is recommended before aliquoting for long-term storage .

Stability Considerations:

  • Brief centrifugation of vials before opening is recommended to bring contents to the bottom, particularly for lyophilized preparations .

  • Monitor for signs of protein degradation if stored for extended periods.

  • Consider adding protease inhibitors for additional stability during experimentation.

Implementing these storage protocols will help maintain the structural integrity and enzymatic activity of Recombinant Mortierella alpina Palmitoyltransferase AKR1 throughout your research project.

How can researchers verify the functionality of recombinant Palmitoyltransferase AKR1 after expression?

Verifying the functionality of recombinant Palmitoyltransferase AKR1 after expression is critical to ensure that experimental results are valid and reproducible. A multi-tiered approach to functionality assessment is recommended:

  • Preliminary Quality Assessment:

    • SDS-PAGE analysis to confirm protein purity and expected molecular weight (approximately 62 kDa for the full-length protein plus tag) .

    • Western blot using anti-His antibodies (for His-tagged versions) or specific antibodies against AKR1.

    • Circular dichroism spectroscopy to evaluate secondary structure integrity.

  • Enzymatic Activity Assays:

    • Primary activity assay using palmitoyl-CoA and appropriate substrate.

    • Kinetic parameter determination (Km, Vmax) to compare with literature values or previous preparations.

    • Comparative activity testing against known palmitoyltransferases with similar substrates.

  • Substrate Specificity Testing:

    • Assay activity with various acyl-CoA donors (palmitoyl-CoA, myristoyl-CoA, stearoyl-CoA) to establish substrate preference profile.

    • Test multiple potential protein or lipid acceptors to determine acceptor substrate specificity.

  • Inhibition Studies:

    • Challenge with known palmitoyltransferase inhibitors to confirm expected inhibition patterns.

    • Test sensitivity to metal chelators if metal ion cofactors are required.

  • Thermal Stability Assessment:

    • Differential scanning fluorimetry (DSF) to determine melting temperature.

    • Activity retention after controlled heat challenge at various temperatures.

By implementing this comprehensive validation workflow, researchers can ensure that their recombinant Palmitoyltransferase AKR1 preparation possesses the expected biochemical properties and is suitable for downstream applications in studying lipid metabolism in Mortierella alpina.

What technical challenges should researchers anticipate when working with Recombinant Mortierella alpina Palmitoyltransferase AKR1?

Researchers working with Recombinant Mortierella alpina Palmitoyltransferase AKR1 should anticipate several technical challenges inherent to this protein's biochemical properties:

  • Solubility and Stability Issues:

    • As a membrane-associated protein with potential transmembrane domains, AKR1 may exhibit limited solubility in aqueous buffers .

    • The protein may be prone to aggregation during concentration steps.

    • Stability may decrease rapidly after reconstitution from lyophilized form without proper additives.

  • Expression Challenges:

    • Potential toxicity to expression hosts due to membrane disruption.

    • Formation of inclusion bodies requiring complex refolding strategies.

    • Variable yield depending on expression conditions and strain selection.

  • Enzymatic Activity Considerations:

    • Requirement for specific lipid environments to maintain native conformation and activity.

    • Potential cofactor dependencies not fully characterized in the literature.

    • Limited commercially available substrates for activity assays.

  • Structural Characterization Difficulties:

    • Challenges in obtaining crystal structures due to membrane association.

    • Difficulty in applying standard structural biology techniques like NMR to this relatively large protein.

  • Experimental Design Complications:

    • Need for specialized detergents or reconstitution into liposomes for activity studies.

    • Potential interference of detergents with activity assays.

    • Reproducibility challenges when working with different protein preparations.

Researchers can address these challenges by:

  • Implementing careful buffer optimization with stabilizing agents

  • Using detergent screening to identify optimal solubilization conditions

  • Considering membrane mimetic systems (nanodiscs, liposomes) for functional studies

  • Developing robust purification protocols with minimal exposure to harsh conditions

  • Preparing larger batches of homogeneous protein to ensure consistency across experiments

How should researchers interpret data from experiments involving Palmitoyltransferase AKR1 in the context of PUFA metabolism?

When interpreting data from experiments involving Palmitoyltransferase AKR1 in the context of PUFA metabolism, researchers should consider several key aspects:

  • Metabolic Context Integration:

    • Evaluate findings within the framework of M. alpina's complex lipid metabolism network .

    • Consider the interconnections between AKR1 activity and other enzymes in the PUFA synthesis pathway, including desaturases and elongases that operate sequentially in ARA production .

    • Analyze how AKR1 activity correlates with cellular concentrations of acetyl-CoA and NADPH, which are critical factors in PUFA biosynthesis .

  • Data Correlation Approaches:

    • Establish relationships between AKR1 activity and PUFA production rates.

    • Compare experimental findings with predictions from genome-scale metabolic models of M. alpina .

    • Consider performing flux balance analysis (FBA) or flux variability analysis (FVA) to contextualize experimental results within the broader metabolic network .

  • Multi-omics Data Integration:

    • Combine enzymatic activity data with transcriptomics, proteomics, and metabolomics data to build a comprehensive understanding.

    • Look for correlations between AKR1 expression levels and changes in lipid profiles.

    • Apply systems biology approaches to identify emergent properties not apparent from isolated experiments.

  • Experimental Controls and Benchmarks:

    • Compare results against known rate-limiting steps in PUFA biosynthesis.

    • Use malic enzyme activity as a benchmark, as it has been established as a key component in ARA production .

    • Consider oxygen availability effects, as oxygen uptake rate significantly impacts PUFA unsaturation levels .

The table below summarizes key metabolic parameters to consider when interpreting AKR1 experimental data:

ParameterRelevance to AKR1 FunctionOptimal Range for ARA Production
Oxygen Uptake RateAffects degree of PUFA unsaturation~2.0 mmol gDW⁻¹ h⁻¹
Acetyl-CoA FluxSubstrate availability for fatty acid synthesis1.56 mmol gDW⁻¹ h⁻¹ during product synthesis
NADPH AvailabilityRequired for desaturation reactionsGenerated by ME and other reactions
Growth RateInfluences carbon partitioning between growth and PUFA synthesis0.03-0.06 h⁻¹ for optimal production

What approaches are recommended for analyzing potential contradictions in experimental results involving Palmitoyltransferase AKR1?

When faced with contradictory results in experiments involving Palmitoyltransferase AKR1, researchers should implement a systematic troubleshooting and analysis approach:

  • Methodological Validation:

    • Verify protein quality across different preparations using SDS-PAGE and activity assays .

    • Confirm assay reproducibility through multiple independent replicates.

    • Evaluate the impact of different buffer compositions, pH values, and assay conditions on activity measurements.

    • Consider fundamental differences between in vitro and in vivo experimental systems.

  • Statistical Analysis Framework:

    • Apply appropriate statistical tests based on data distribution and experimental design.

    • Utilize outlier detection methods to identify potentially anomalous data points.

    • Calculate confidence intervals to determine the reliability of measurements.

    • Consider Bayesian approaches when integrating prior knowledge with new experimental findings.

  • Systematic Variation Analysis:

    • Implement design of experiments (DOE) methodology to systematically explore factors affecting AKR1 activity.

    • Develop response surface models to understand how multiple variables interact to influence enzyme behavior.

    • Use principal component analysis (PCA) to identify patterns in multivariate data sets that might explain apparent contradictions.

  • Technical Considerations:

    • Evaluate potential protein stability issues across different experimental conditions .

    • Consider the impact of freeze-thaw cycles on enzyme activity .

    • Assess whether recombinant tag positions (N-terminal vs C-terminal) affect enzyme function .

    • Investigate substrate quality and purity as potential sources of variability.

  • Biological Context Evaluation:

    • Consider whether contradictory results might reflect actual biological regulation mechanisms.

    • Evaluate potential context-dependent functions of AKR1 in different metabolic states.

    • Assess whether observed contradictions align with known regulatory patterns in PUFA metabolism .

How can Recombinant Mortierella alpina Palmitoyltransferase AKR1 be utilized in metabolic engineering applications?

Recombinant Mortierella alpina Palmitoyltransferase AKR1 presents several opportunities for metabolic engineering applications, particularly in systems designed to enhance or modify PUFA production:

  • PUFA Production Enhancement:

    • Overexpression of AKR1 could potentially increase fatty acid modification capacity if this enzyme represents a rate-limiting step in specific palmitoylation reactions relevant to PUFA synthesis .

    • Co-expression with other key enzymes involved in PUFA biosynthesis might create synergistic effects that enhance productivity.

    • Integration into heterologous hosts could potentially transfer aspects of M. alpina's exceptional lipid production capabilities to industrial organisms.

  • Pathway Engineering Strategies:

    • Targeted modification of AKR1 substrate specificity through protein engineering could potentially alter fatty acid profiles.

    • Expression of AKR1 variants with modified regulatory properties might bypass natural feedback inhibition mechanisms.

    • Systems biology approaches using genome-scale metabolic models could predict optimal intervention points involving AKR1 for maximizing PUFA production .

  • Process Optimization Applications:

    • Immobilized AKR1 could potentially serve in biocatalytic applications for specific modification of fatty acids or lipids.

    • Development of biosensors incorporating AKR1 domains might enable real-time monitoring of relevant metabolites in production systems.

    • In vitro enzymatic systems combining multiple enzymes including AKR1 might provide novel routes to valuable PUFA derivatives.

  • Research Tool Applications:

    • Using recombinant AKR1 to identify interaction partners might reveal new regulatory mechanisms in PUFA metabolism.

    • Structure-function studies with engineered variants could elucidate the molecular basis of substrate specificity.

    • Development of specific inhibitors based on AKR1 structure could provide valuable research tools for dissecting metabolic pathways.

When designing metabolic engineering strategies involving AKR1, researchers should consider the optimal expression conditions established for the recombinant protein and the specific metabolic context of their target system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.