Recombinant Morus indica Apocytochrome f (petA)

What is Recombinant Morus indica Apocytochrome f (petA) protein?

Recombinant Morus indica Apocytochrome f (petA) is a full-length mature protein (amino acids 36-320) derived from mulberry (Morus indica) species. The protein is encoded by the petA gene (UniProt ID: Q09X04) and typically expressed in E. coli with an N-terminal His-tag for purification purposes. Functionally, Apocytochrome f is a component of the cytochrome complex involved in electron transport within the photosynthetic pathway of plants .

How does the structure of Recombinant Morus indica Apocytochrome f compare to other plant cytochromes?

While specific structural comparison data for Morus indica Apocytochrome f is limited in the provided research, general cytochrome f proteins contain characteristic heme-binding domains with conserved motifs across plant species. The protein typically features a membrane-spanning domain (evident in the C-terminal hydrophobic region visible in the sequence "LLLFLASIILAQIFLVLKKKQFEKVQLSEMNF") and a large soluble domain containing the heme group. Structural conservation analysis indicates the functional domains responsible for electron transport are preserved across species, though species-specific variations can affect protein stability and interaction profiles .

What are the optimal storage conditions for Recombinant Morus indica Apocytochrome f?

For optimal stability and activity retention, Recombinant Morus indica Apocytochrome f should be stored according to the following guidelines:

Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity and activity .

What is the recommended reconstitution protocol for lyophilized Recombinant Morus indica Apocytochrome f?

The recommended reconstitution protocol involves:

• Briefly centrifuge the vial prior to opening to ensure the protein content is at the bottom

• Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is typically recommended) for long-term storage

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• Store aliquots at -20°C/-80°C for extended preservation

How can researchers verify the purity and activity of Recombinant Morus indica Apocytochrome f?

Researchers should implement a multi-faceted validation approach:

• SDS-PAGE analysis: Commercial preparations typically ensure >90% purity as determined by SDS-PAGE; researchers should verify this with Coomassie or silver staining

• Western blot analysis: Using anti-His tag antibodies (for His-tagged versions) or specific anti-Apocytochrome f antibodies

• Spectrophotometric analysis: Monitoring characteristic absorbance peaks of the heme group (if present in the reconstituted protein)

• Functional assays: Electron transfer capability assessments in reconstituted systems

• Mass spectrometry: For precise molecular weight confirmation and detection of post-translational modifications

How does Recombinant Morus indica Apocytochrome f function in electron transport chains?

Apocytochrome f serves as a critical component in the photosynthetic electron transport chain, specifically in the cytochrome b6f complex. The protein functions by:

• Accepting electrons from plastoquinol

• Transferring electrons to plastocyanin or cytochrome c6

• Contributing to the generation of a proton gradient across the thylakoid membrane

• Facilitating ATP synthesis through this proton motive force

The specific heme-binding region with the conserved CXXCH motif (visible in the sequence as "CANCHLA") forms the redox-active site that enables electron transfer. The recombinant protein can be utilized in in vitro electron transport assays to study these mechanisms or comparative analysis between species .

What experimental systems can benefit from using Recombinant Morus indica Apocytochrome f?

Several experimental systems can benefit from this recombinant protein:

• Photosynthesis research: Investigating electron transport chain components and efficiency

• Plant adaptation studies: Comparative analysis of cytochrome f variants across different plant species and adaptation to environmental conditions

• Protein-protein interaction studies: Pull-down assays to identify interaction partners within the photosynthetic machinery

• Structural biology: Crystallization trials and structural analysis of plant-specific cytochrome variants

• Antibody development: As an immunogen for generating specific antibodies against plant cytochromes

How can Recombinant Morus indica Apocytochrome f be used in comparative studies with other Morus species?

Researchers can utilize this recombinant protein for:

• Evolutionary studies: Sequence and functional comparison with cytochrome f from other Morus species like M. alba or M. atropurpurea

• Photosynthetic efficiency analysis: Comparing electron transport capabilities between species

• Adaptation mechanisms: Investigating species-specific adaptations in photosynthetic machinery

• Polyploidy effects: Studying how genome duplication (as in autotetraploid mulberry) affects protein expression and function

• Conservation analysis: Identifying conserved domains that may be critical for function across the Morus genus

What are common challenges in expressing and purifying Recombinant Morus indica Apocytochrome f?

Researchers frequently encounter several challenges:

• Protein solubility issues: The membrane-spanning domain can cause aggregation during expression

• Heme incorporation: Ensuring proper incorporation of the heme group during recombinant expression

• Folding problems: Achieving correct folding of the protein in bacterial expression systems

• Purification interference: His-tag accessibility may be limited by protein conformation

• Activity preservation: Maintaining electron transfer capability after purification

Troubleshooting approaches:

• Expression at lower temperatures (16-18°C) to improve folding

• Co-expression with chaperones to enhance correct folding

• Addition of heme precursors to the culture medium

• Optimization of lysis and purification buffers with appropriate detergents

• Using larger solubility tags (MBP, SUMO) instead of simple His-tags

How can researchers design experiments to investigate the interaction between Recombinant Morus indica Apocytochrome f and other components of the photosynthetic machinery?

Advanced experimental design strategies include:

• Surface Plasmon Resonance (SPR): Quantify binding kinetics between Apocytochrome f and potential interaction partners like plastocyanin

• Isothermal Titration Calorimetry (ITC): Determine thermodynamic parameters of protein-protein interactions

• Co-immunoprecipitation with antibody arrays: Identify novel interaction partners

• Hydrogen-deuterium exchange mass spectrometry: Map interaction surfaces between proteins

• FRET-based assays: Monitor real-time interactions and conformational changes

• Cryo-EM studies: Visualize multi-protein complexes incorporating the recombinant protein

What are the considerations for developing antibodies against Recombinant Morus indica Apocytochrome f?

Researchers developing antibodies should consider:

• Epitope selection: Identifying unique, surface-exposed regions of the protein that don't cross-react with homologs

• Recombinant vs. animal-derived antibodies: Following ethical considerations, recombinant antibody technologies offer advantages in reproducibility and specificity

• Validation strategies: Multiple methods including Western blot, immunoprecipitation, and immunohistochemistry should be used to confirm specificity

• Cross-reactivity testing: Ensuring antibodies don't recognize related proteins from other species unless specifically designed to do so

• Application-specific optimization: Different applications (Western blot vs. immunoprecipitation) may require different antibody characteristics

How can researchers investigate post-translational modifications of Recombinant Morus indica Apocytochrome f?

Post-translational modification analysis requires sophisticated methodologies:

• Mass spectrometry approaches:

  • High-resolution LC-MS/MS for site-specific identification

  • Targeted multiple reaction monitoring (MRM) for quantification

  • Electron transfer dissociation (ETD) for preserving labile modifications

• Modification-specific detection methods:

  • Phospho-specific antibodies for phosphorylation

  • ProQ Diamond staining for phosphoproteins

  • Anti-ubiquitin antibodies for ubiquitination

• Functional impact assessment:

  • Site-directed mutagenesis of modification sites

  • Activity assays comparing modified vs. unmodified forms

  • Structural studies to determine conformation changes induced by modifications

How does Recombinant Morus indica Apocytochrome f compare to the same protein in polyploid Morus species?

The comparison between diploid and polyploid Morus species presents an interesting research avenue:

• Expression levels: Polyploid plants often show altered gene expression patterns, potentially affecting cytochrome f levels

• Sequence variations: Minor amino acid differences may exist, affecting protein stability or activity

• Post-translational modification patterns: Polyploidization can alter regulatory pathways affecting protein modifications

• Functional efficiency: Comparison of electron transport rates between diploid and polyploid-derived proteins

• Structural adaptations: Potential conformational differences that may correlate with adaptation to different environmental conditions

What bioinformatic approaches can be used to study the evolutionary conservation of Apocytochrome f across plant species?

Sophisticated bioinformatic analyses can reveal evolutionary patterns:

• Multiple sequence alignment (MSA): Identifying conserved domains across species

• Phylogenetic analysis: Constructing evolutionary trees to understand relatedness

• Selection pressure analysis: Calculating dN/dS ratios to identify regions under purifying or positive selection

• Homology modeling: Predicting structural conservation based on sequence similarity

• Coevolution analysis: Identifying co-evolving residues that may be functionally linked

• Ancestral sequence reconstruction: Inferring ancestral cytochrome f sequences to understand evolutionary trajectories