Recombinant Morus indica ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Identity & Production

Recombinant atpI (UniProt ID: Q09X29) is a 247-amino acid polypeptide expressed in E. coli with an N-terminal His tag for purification . Key specifications include:

ParameterDetail
Host SystemEscherichia coli
TagN-terminal His tag
Molecular Weight~28 kDa (calculated)
Purity>85% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; -20°C/-80°C for long-term storage

The protein corresponds to the full-length atpI gene (GenBank: MoinCp009) encoding subunit a of the chloroplast ATP synthase complex .

Enzyme Mechanism Studies

  • Used to analyze H⁺/ATP coupling efficiency in chloroplasts

  • Key for mutational studies on conserved residues (e.g., Glu58) affecting proton transport

Drug Discovery

  • Target for phytochemicals like mulberrofuran D2, which inhibits ATP-binding pockets in neurodegenerative pathways

  • Structural insights aid in designing allosteric modulators

Immunological Assays

  • Available as an ELISA-grade antigen (Cat. No. RFL25045MF) for antibody validation

Comparative Analysis with Other Subunits

SubunitGeneLocationFunctionUniProt ID
a (atpI)atpIF₀ domainH⁺ translocation, rotor assemblyQ09X29
β (atpB)atpBF₁ domainATP hydrolysis/synthesisQ09X10

Subunit a lacks catalytic activity but is essential for coupling proton flow to mechanical rotation .

Quality Control & Validation

  • Purity: Validated by SDS-PAGE and reverse-phase HPLC

  • Activity: Functional assays measure H⁺-dependent ATP synthesis in reconstituted liposomes

  • Stability: Avoid freeze-thaw cycles; working aliquots stable at 4°C for 1 week

Genomic & Evolutionary Insights

  • The atpI gene is encoded in the chloroplast genome

  • Morus species show mitogenome plasticity, with atp9 duplication in M. alba cultivars

  • Codon usage bias (RSCU >1 for GCU-Ala) reflects evolutionary optimization for translation efficiency

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
atpI; MoinCp009; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Morus indica (Mulberry)
Target Names
atpI
Target Protein Sequence
MNVLLCSINTLKGLYDISGVEVGQHLYWKIGGFQVHAQVLITSWVVIAILLGSSIIAVRN PQTIPTDGQNFFEYVLEFIRDVSRTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, ATP synthase subunit a plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does Morus indica ATP synthase structure compare with other plant species?

The structure of Morus indica ATP synthase shares fundamental similarities with other plant ATP synthases, containing both F1 (catalytic) and F0 (membrane) sectors. Based on comparative studies of ATP synthase complexes, the F1 sector typically consists of subunits α, β, γ, δ, and ε, while the F0 sector includes subunits a, b, and c. In plants including Morus species, the chloroplastic ATP synthase has evolved specific adaptations for functioning in the thylakoid membrane environment.

A significant feature of mycobacterial ATP synthases that might provide insights into plant ATP synthases is the presence of unique extensions or domains in certain subunits. For instance, mycobacterial subunit α contains a specific 36-amino acid C-terminal domain that suppresses ATPase activity . While not directly comparable, such structural variations highlight how ATP synthases from different organisms have evolved unique regulatory mechanisms that might also be present in Morus indica.

What expression systems are most suitable for producing recombinant Morus indica atpI?

For successful expression of recombinant Morus indica ATP synthase subunit a (atpI), bacterial expression systems, particularly Escherichia coli, have proven effective for related ATP synthase subunits. As demonstrated with the recombinant Morus indica ATP synthase subunit c (atpH), E. coli can successfully express chloroplastic ATP synthase components with appropriate tags for purification .

When designing an expression system for atpI:

  • Select a strain optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3))

  • Consider using a vector with an inducible promoter (such as T7)

  • Include an affinity tag (typically His-tag) for purification

  • Optimize codon usage for E. coli if necessary

  • Control expression temperature (typically 18-25°C) to prevent inclusion body formation

This approach allows for the production of sufficient quantities of functional protein for subsequent biochemical and structural studies.

How can deletion mutants be designed to study functional domains of Morus indica atpI?

Designing deletion mutants requires strategic removal of specific amino acid sequences to investigate their functional significance. Based on methods used for mycobacterial ATP synthase subunits, researchers can apply similar approaches to Morus indica atpI:

  • First, perform sequence alignment and structural prediction to identify conserved and variable regions within the atpI protein.

  • Design PCR primers that flank the regions to be deleted, incorporating appropriate restriction sites.

  • Use overlapping PCR or site-directed mutagenesis techniques to generate the deletion constructs.

  • Express both wild-type and mutant proteins in a suitable expression system such as E. coli.

  • Purify the proteins using affinity chromatography, typically with His-tagged constructs.

  • Assess functional changes using ATP synthesis/hydrolysis assays and proton-pumping measurements.

In studies with mycobacterial ATP synthase, deletion of the C-terminal domain of subunit α (Δα514-548 and Δα521-540) resulted in significant increases in ATPase activity and enabled proton-pumping activity . Similar methodologies could be applied to identify functional domains in Morus indica atpI.

What techniques can accurately measure ATP synthesis activity of recombinant atpI-containing complexes?

To accurately measure ATP synthesis activity of recombinant atpI-containing complexes, researchers should employ multiple complementary techniques:

  • Inverted Membrane Vesicle (IMV) Assays: Prepare IMVs containing reconstituted atpI and measure ATP synthesis driven by an artificially imposed proton gradient. This approach allows measurement of the enzyme in a near-native membrane environment.

  • Luciferase-Based ATP Detection: Couple ATP synthesis to bioluminescence reactions using luciferase, allowing real-time monitoring of ATP production with high sensitivity.

  • Radioisotope-Based Assays: Use radiolabeled ADP (³²P-ADP) to track the formation of radiolabeled ATP, providing quantitative measurements of synthesis rates.

  • Proton Pumping Measurements: For evaluating the coupling between ATP synthesis/hydrolysis and proton movement, fluorescent dyes such as 9-amino-6-chloro-2-methoxyacridine (ACMA) can be employed. When protons are pumped into IMVs, ACMA fluorescence is quenched, providing a readout of proton-pumping activity .

These techniques should be used in conjunction with appropriate controls, including uncouplers like SF6847 to verify the specificity of the proton gradient-dependent signals .

How do site-specific mutations in atpI affect proton translocation mechanics?

Site-specific mutations in atpI can significantly impact proton translocation mechanics, as demonstrated by research on related ATP synthase subunits. To investigate these effects:

  • Identify Critical Residues: Based on sequence conservation and structural models, identify potential proton-conducting residues in atpI (typically charged or polar amino acids).

  • Generate Point Mutations: Use site-directed mutagenesis to replace these residues with amino acids of different chemical properties (e.g., replace charged with neutral residues).

  • Functional Assays: Compare wild-type and mutant proteins using:

    • Proton pumping assays with fluorescent dyes like ACMA

    • ATP synthesis measurements in reconstituted systems

    • Single-molecule rotation assays if applicable

  • Structural Analysis: Complement functional studies with structural analyses using techniques such as X-ray crystallography, cryo-electron microscopy, or NMR to determine how mutations alter the proton channel architecture.

Research on mycobacterial ATP synthase revealed that specific domains can suppress ATPase activity and affect proton pumping. For instance, deletion of the C-terminal domain in mycobacterial subunit α enabled ATP-driven proton pumping, with fluorescence quenching of approximately 10% . Similar methodological approaches could be applied to Morus indica atpI to identify residues critical for proton translocation.

What are the most effective methods for determining the structure of Morus indica atpI?

Determining the structure of membrane proteins like Morus indica atpI presents significant challenges. The most effective methods include:

For membrane proteins like atpI, a combination of these methods often provides the most comprehensive structural information.

How can molecular dynamics simulations enhance understanding of atpI function?

Molecular dynamics (MD) simulations offer powerful insights into the dynamic behavior of atpI that may not be apparent from static structural data:

  • System Preparation:

    • Build a molecular model of atpI based on homology modeling or experimental structures

    • Embed the protein in a lipid bilayer that mimics the chloroplast membrane

    • Solvate the system with explicit water molecules and add ions to achieve physiological ionic strength

  • Simulation Parameters:

    • Use established force fields optimized for membrane proteins (e.g., CHARMM36 or AMBER)

    • Run simulations for sufficient time to observe relevant motions (typically 100ns-1μs)

    • Employ periodic boundary conditions and appropriate temperature/pressure controls

  • Analysis Approaches:

    • Investigate proton pathways through the protein

    • Examine conformational changes in response to protonation states

    • Calculate interaction energies between atpI and other subunits

    • Study water dynamics within the proton channel

  • Advanced Techniques:

    • Implement enhanced sampling methods (metadynamics, umbrella sampling) to study rare events

    • Use computational electrophysiology to simulate proton translocation

    • Apply QM/MM methods for investigating proton transfer reactions

MD simulations can complement experimental methods to provide atomic-level insights into proton translocation mechanisms, conformational dynamics, and the effects of mutations on atpI function.

What statistical approaches are recommended for analyzing atpI functional assay results?

For robust analysis of atpI functional assay results, the following statistical approaches are recommended:

  • Experimental Design Considerations:

    • Always perform experiments in at least triplicate to ensure reproducibility

    • Include appropriate positive and negative controls

    • Use randomization and blinding where applicable

  • Descriptive Statistics:

    • Report means with measures of dispersion (standard deviation or standard error)

    • Generate appropriate graphical representations (bar charts, box plots, scatter plots)

  • Inferential Statistics:

    • Use one-way ANOVA to compare multiple experimental groups, as employed in studies of Morus species bioactivities

    • Apply post-hoc tests (e.g., Tukey's HSD) for pairwise comparisons

    • Consider non-parametric alternatives (Kruskal-Wallis, Mann-Whitney) if data are not normally distributed

  • Regression Analysis:

    • For dose-response relationships, use regression analysis to determine EC50 values

    • Report R² values to indicate goodness of fit

  • Software Tools:

    • Utilize statistical software such as SPSS (version 20 or later) for data analysis

    • Generate publication-quality graphs using tools like GraphPad Prism

  • Reporting Standards:

    • Clearly state statistical methods in methods sections

    • Report exact p-values rather than arbitrary significance thresholds

    • Consider statistical power when interpreting negative results

These approaches align with standard practices in biochemical research and have been successfully applied in studies of Morus species .

How should researchers interpret changes in ATP synthesis rates between wild-type and mutant atpI?

Interpreting changes in ATP synthesis rates between wild-type and mutant atpI requires careful consideration of multiple factors:

  • Direct vs. Indirect Effects:

    • Determine whether mutations directly affect the catalytic mechanism or indirectly alter protein stability, assembly, or interactions

    • Compare protein expression levels and membrane integration efficiency between wild-type and mutants

  • Quantitative Analysis:

    • Calculate percent change in activity relative to wild-type

    • Determine kinetic parameters (Vmax, Km) for both wild-type and mutant proteins

    • As observed with mycobacterial ATP synthase mutants, deletion of regulatory domains can increase ATPase activity by specific percentages (e.g., 64% increase for Δα514-548)

  • Structure-Function Correlation:

    • Relate functional changes to specific structural elements

    • Consider how mutations might alter proton pathways or conformational dynamics

    • For instance, in mycobacterial ATP synthase, the C-terminal helix of subunit α contributes to regulation of catalytic and coupling events

  • Coupling Efficiency:

    • Assess whether changes in ATP synthesis correlate with changes in proton pumping

    • Calculate the H⁺/ATP ratio to determine coupling efficiency

    • In mycobacterial ATP synthase studies, deletion mutants showed both increased ATP hydrolysis and enabled proton pumping, indicating a restoration of coupling

  • Comparison with Known Mutants:

    • Compare results with similar mutations in homologous proteins from other organisms

    • Identify conserved vs. species-specific effects

This comprehensive approach enables researchers to distinguish between mutations that affect specific mechanistic steps versus those that cause global structural disruptions.

How can single-molecule techniques be applied to study atpI function?

Single-molecule techniques offer unique insights into the dynamics and mechanisms of ATP synthase components like atpI:

  • Single-Molecule Rotation Assays:

    • Attach a fluorescent probe (bead or gold nanorod) to the rotary subunit of the ATP synthase complex

    • Observe rotation using fluorescence microscopy with high temporal resolution

    • Analyze rotation speed, direction, and step size under various conditions

    • These techniques have revealed that specific domains can influence the angular velocity of the power-stroke after ATP binding

  • Fluorescence Resonance Energy Transfer (FRET):

    • Label atpI and interacting subunits with donor and acceptor fluorophores

    • Monitor distances between labeled sites during catalysis

    • Detect conformational changes during proton translocation

  • Atomic Force Microscopy (AFM):

    • Image the topography of reconstituted atpI in lipid bilayers

    • Measure force-distance curves to assess mechanical properties

    • Observe conformational changes in response to pH gradients or nucleotide binding

  • Patch-Clamp Electrophysiology:

    • Incorporate purified atpI into artificial lipid bilayers

    • Measure proton currents through the channel under voltage-clamp conditions

    • Determine conductance properties and voltage dependence

  • Analysis Approaches:

    • Use hidden Markov modeling to identify discrete states

    • Apply dwell-time analysis to determine kinetic parameters

    • As demonstrated in studies of F-ATP synthases, single-molecule rotation assays can distinguish between different phases of the catalytic cycle and measure angular velocities during the power stroke

These techniques provide mechanistic insights that are not obtainable from bulk measurements and are particularly valuable for understanding the coordinated movements within the ATP synthase complex.

What are the most reliable methods for investigating interactions between atpI and other ATP synthase subunits?

Investigating protein-protein interactions between atpI and other ATP synthase subunits requires a combination of biochemical, biophysical, and computational approaches:

  • Cross-linking Studies:

    • Use chemical cross-linkers with different spacer lengths to capture interacting residues

    • Analyze cross-linked products by mass spectrometry to identify interaction sites

    • This approach has been successfully used to map interactions between ATP synthase subunits, such as the interaction between subunit α and γ in mycobacterial ATP synthase

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against atpI or use epitope tags

    • Precipitate atpI and identify interacting partners by Western blotting or mass spectrometry

    • Verify specificity using appropriate controls

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified atpI on a sensor chip

    • Flow solutions containing potential interacting partners

    • Measure binding kinetics and affinities in real-time

  • Fluorescence Correlation Spectroscopy (FCS):

    • Label proteins with fluorescent tags

    • Measure diffusion coefficients to detect complex formation

    • Determine binding affinities for ATP or ADP, as demonstrated with ATP synthase subunits

  • Structural Biology Approaches:

    • Use cryo-EM to visualize the entire ATP synthase complex

    • Perform NMR studies on specific domains to identify interaction surfaces

    • Apply X-ray crystallography to co-crystals of interacting domains

  • Computational Methods:

    • Perform protein-protein docking simulations

    • Use molecular dynamics to study the stability of predicted complexes

    • Calculate binding energies and identify key interacting residues

These complementary approaches provide a comprehensive understanding of how atpI integrates into the ATP synthase complex and interacts with neighboring subunits.

How can researchers overcome expression and purification challenges for recombinant atpI?

Membrane proteins like atpI present unique challenges during expression and purification. The following strategies can help overcome these obstacles:

  • Optimization of Expression Systems:

    • Test multiple E. coli strains designed for membrane protein expression (C41, C43, Lemo21)

    • Consider alternative expression hosts (insect cells, yeast)

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • As demonstrated with Morus indica ATP synthase subunit c, successful expression can be achieved in E. coli with appropriate optimization

  • Improving Protein Solubility:

    • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Co-express with chaperones to aid proper folding

    • Consider expressing individual domains separately if the full-length protein is problematic

  • Extraction and Purification Strategies:

    • Screen multiple detergents for optimal extraction (DDM, LMNG, digitonin)

    • Implement two-phase extraction for improved yields

    • Use affinity chromatography (typically His-tag) followed by size exclusion chromatography

    • Consider nanodiscs or amphipols for stabilizing the purified protein

  • Quality Control Measures:

    • Verify protein identity using mass spectrometry

    • Assess homogeneity via dynamic light scattering

    • Confirm proper folding using circular dichroism spectroscopy

    • Validate functionality through activity assays

  • Storage Conditions:

    • Optimize buffer composition (pH, salt concentration, additives)

    • Test different storage temperatures (-80°C, -20°C, 4°C)

    • Evaluate the need for glycerol or other stabilizing agents

    • Determine maximum storage duration without loss of activity

By systematically addressing these aspects, researchers can significantly improve the yield and quality of recombinant atpI for subsequent structural and functional studies.

What controls are essential when measuring ATP synthase activity in reconstituted systems?

When measuring ATP synthase activity in reconstituted systems containing atpI, the following controls are essential for reliable and interpretable results:

  • Negative Controls:

    • Protein-free liposomes to assess background signals

    • Denatured enzyme preparations to confirm that observed activity requires properly folded protein

    • Assays in the absence of essential substrates (ATP, ADP, Pi)

  • Positive Controls:

    • Well-characterized ATP synthase from model organisms (E. coli, bovine)

    • Activity measurements under optimal conditions before experimental manipulations

  • Specificity Controls:

    • Include specific inhibitors:

      • Oligomycin (F0 inhibitor)

      • Venturicidin (inhibits proton translocation)

      • DCCD (modifies essential carboxyl groups in subunit c)

    • Use uncouplers (SF6847, FCCP) to dissipate proton gradients and verify coupling between ATP synthesis/hydrolysis and proton movement

  • System Integrity Controls:

    • Measure proton leakage rates in liposomes/vesicles

    • Verify membrane integrity using membrane-impermeable dyes

    • As demonstrated in studies with IMVs, addition of NADH can be used to verify the functional integrity of the reconstituted system

  • Technical Controls:

    • Instrument baseline measurements

    • Calibration curves for ATP/ADP quantification

    • Time-course measurements to ensure linearity

  • Biological Validation:

    • Compare wild-type and known mutant enzymes

    • Verify directionality (synthesis vs. hydrolysis)

    • Test under different energetic conditions (varying ATP/ADP ratios, different pH gradients)

These controls help distinguish specific ATP synthase activity from non-specific reactions and ensure that the reconstituted system accurately represents the native enzyme function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.