Recombinant Morus indica Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Chloroplast Genome Context of cemA in Morus indica

The cemA gene is a core component of chloroplast genomes in Morus species, including M. indica. Chloroplast genomes of Morus exhibit a conserved quadripartite structure with large single-copy (LSC), small single-copy (SSC), and inverted repeat (IR) regions.

Table 1: Chloroplast Genome Features of Morus indica

FeatureM. indica (NC_008359)Other Morus Species
Genome Size158,484 bp158,459–159,265 bp
GC Content36.37%36.16–36.37%
Inverted Repeats (IR)25,678 bp each25,639–25,717 bp
LSC Region87,386 bp87,367–88,243 bp
SSC Region19,742 bp19,736–20,035 bp

Data compiled from .

The cemA gene encodes a polytopic membrane protein localized to the inner chloroplast envelope membrane. In Morus species, cemA is annotated in chloroplast genomes but lacks functional characterization.

Gene Structure and SSRs

Chloroplast genomes of Morus species, including M. indica, contain 83–85 simple sequence repeats (SSRs), many located within coding regions like cemA. SSRs in cemA include mononucleotide repeats, which are prevalent in Morus chloroplasts .

Sequence Homology

The cemA gene in Morus shares homology with cemA homologs in other plants (e.g., Barbarea verna, Nephroselmis olivacea) and algae. For instance:

  • Barbarea verna cemA: Full-length (1–229 aa), His-tagged recombinant protein expressed in E. coli .

  • Nephroselmis olivacea cemA: Full-length (1–392 aa), His-tagged recombinant protein expressed in E. coli .

While M. indica’s cemA sequence is not explicitly published, its length is inferred to align with angiosperm cemA homologs (typically 200–300 aa).

Proposed Functions

  1. Proton Extrusion and Carbon Uptake:
    Studies in Chlamydomonas suggest cemA homologs facilitate proton extrusion, enabling efficient inorganic carbon uptake into plastids . This aligns with cemA’s localization to the inner envelope membrane.

  2. Heme Interaction:
    Structural homology to heme-binding domains implies a potential role in heme attachment or redox processes .

Research Gaps

No functional studies explicitly target cemA in Morus species. Current knowledge relies on:

  • Comparative Genomics: SSRs and GC content patterns in cemA across Morus .

  • Homology-Based Inference: Functional data from non-Morus species .

Potential Applications of Recombinant cemA

While M. indica’s recombinant cemA remains unreported, its hypothetical production could enable:

Application AreaRationale
BiotechnologyStudy proton transport mechanisms in chloroplasts; optimize carbon assimilation in crops.
PhylogeneticsSSR markers in cemA could aid Morus species identification .
Protein EngineeringHis-tagged recombinant proteins (e.g., Barbarea verna cemA ) provide templates for structural studies.

Challenges and Future Directions

  1. Recombinant Production:

    • M. indica’s nuclear genome sequence (K2 cultivar) is available , but chloroplast-derived recombinant proteins remain underexplored.

    • Established protocols for cemA recombinant expression in E. coli (e.g., His-tagged proteins ) could be adapted.

  2. Functional Validation:

    • CRISPR-based knockout studies or GFP-fusion localization experiments are needed to confirm cemA’s role in Morus.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your desired format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its development.
Synonyms
cemA; MoinCp033; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Morus indica (Mulberry)
Target Names
cemA
Target Protein Sequence
MAKKKAFISLLYLASIVFLPWWISLSFTFNKSLESWVNNWWNTRPSEILLNDIQEKSILK KFIELEELSLFDEMLKEYSERRLQKLHVGVYNETIQWIKMHNEGRIHTILHFSTNIISFV ILSVFSILSNEELIFLNSCLQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSIY KDFGFAHNDQIISGVVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What isolation techniques are most effective for purifying chloroplast envelope membrane proteins from Morus species?

The isolation of chloroplast envelope membrane proteins from Morus species requires a systematic approach due to their low abundance. The most effective protocol involves:

  • Tissue disruption in isotonic buffer conditions

  • Differential centrifugation to obtain crude chloroplast pellets

  • Purification on Percoll gradients to obtain intact chloroplasts

  • Osmotic shock to release envelope membranes

  • Separation of envelope membranes by sucrose gradient ultracentrifugation

Recent advancements in chloroplast envelope isolation techniques have significantly improved protein recovery. The purity of isolated fractions should be verified using Western blot analysis with antibodies against known compartmental markers such as HMA1 for the envelope, LHCP for thylakoids, KARI for stroma, BiP for endoplasmic reticulum, V-ATPase for tonoplast, and FtsY for general plastid components .

When working specifically with Morus species, researchers should optimize buffers and centrifugation parameters to account for species-specific leaf characteristics, particularly the higher concentration of secondary metabolites that may interfere with protein extraction and analysis.

How can researchers distinguish genuine chloroplast envelope proteins from contaminants during proteomic analysis?

Distinguishing genuine chloroplast envelope proteins from contaminants remains a significant challenge in organellar proteomics. The most reliable approach is calculating an Enrichment Factor (EF) for each protein by comparing its abundance in purified envelope fractions relative to crude cell extracts. This quantitative parameter serves as a powerful tool to differentiate authentic envelope components from contaminants .

A methodological workflow should include:

  • Parallel processing of purified envelope fractions and crude cell extracts

  • Mass spectrometry analysis of both samples under identical conditions

  • Calculation of spectral count ratios between envelope and total cell fractions

  • Manual annotation using literature data and prediction tools

  • Validation of selected candidates using fluorescent protein tagging or immunolocalization

Research has shown that genuine envelope proteins typically exhibit significantly higher EF values compared to contaminants. For example, in Arabidopsis studies, known envelope transporters showed EF values >10, while abundant proteins from other compartments displayed EF values <1 . Application of this approach to Morus species would follow similar principles with species-specific optimizations.

What expression systems are optimal for recombinant production of Morus indica cemA, and how should they be optimized?

The recombinant expression of chloroplast envelope membrane proteins presents unique challenges due to their hydrophobic nature and potential toxicity to host cells. For M. indica cemA, researchers should consider the following expression systems with specific optimizations:

Bacterial Expression Systems:

  • E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

  • Growth at reduced temperatures (16-20°C) to enhance proper folding

  • Fusion with solubility-enhancing tags (MBP, SUMO, or Trx)

  • Codon optimization for E. coli with particular attention to rare codons in M. indica

Eukaryotic Expression Systems:

  • Yeast (P. pastoris) for expression of full-length membrane proteins

  • Plant-based transient expression in Nicotiana benthamiana

  • Insect cell systems (Sf9 or Hi5) using baculovirus vectors

Critical optimization parameters include induction conditions, detergent selection for membrane protein solubilization, and purification strategies. For chloroplast envelope proteins, mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often yield superior results for maintaining native structure. The expression construct should be designed with affinity tags positioned to minimize interference with protein folding and function.

How do post-translational modifications affect cemA function, and what techniques can identify these modifications?

Post-translational modifications (PTMs) of chloroplast envelope proteins, including cemA, can significantly impact their localization, stability, and function. While specific data on M. indica cemA modifications are not available, research on chloroplast proteins indicates several potential PTMs:

  • Phosphorylation - regulating protein activity and interactions

  • Acetylation - influencing protein stability and targeting

  • Ubiquitination - controlling protein turnover

  • Palmitoylation - affecting membrane association

To identify and characterize these modifications, researchers should employ a multi-technique approach:

Mass Spectrometry-Based Techniques:

  • Enrichment strategies for phosphopeptides using TiO₂ or IMAC

  • Targeted MS/MS analysis focusing on predicted modification sites

  • Label-free quantification to assess modification stoichiometry

Biochemical Approaches:

  • Phosphatase treatment coupled with mobility shift assays

  • Site-directed mutagenesis of putative modification sites

  • In vitro modification assays using chloroplast extracts

Analysis of PTMs should be performed in different physiological conditions, as environmental factors may influence modification patterns. For instance, stress conditions like pathogen exposure may alter the phosphorylation status of chloroplast envelope proteins, potentially connecting to the observed bioactivities of Morus extracts .

What structural features of cemA contribute to its function in the chloroplast envelope membrane?

The structural characteristics of cemA that enable its functions in the chloroplast envelope membrane remain incompletely understood, particularly for Morus species. Based on bioinformatic analyses and structural studies of related membrane proteins, several key features likely contribute to cemA functionality:

  • Transmembrane helices forming membrane-spanning domains

  • Hydrophilic loops extending into stromal or intermembrane space

  • Potential oligomerization domains for complex formation

  • Specific binding pockets for substrate/ligand interactions

To elucidate these structural features, researchers should consider:

Computational Approaches:

  • Homology modeling based on related structures

  • Molecular dynamics simulations to predict membrane interactions

  • Co-evolution analysis to identify functional domains

Experimental Methods:

  • Cryo-electron microscopy for structural determination

  • Limited proteolysis coupled with MS to map topology

  • Cross-linking studies to identify interaction interfaces

Understanding the structure-function relationship of cemA requires integrating these approaches with functional assays. For instance, site-directed mutagenesis of predicted functional residues followed by activity assays can validate structural hypotheses.

What mass spectrometry protocols are most effective for analyzing low-abundance chloroplast envelope proteins like cemA?

Mass spectrometry analysis of low-abundance chloroplast envelope proteins requires specialized protocols to overcome technical challenges. The most effective approach combines targeted enrichment with sensitive detection methods:

Sample Preparation:

  • Fractionation of chloroplast compartments to concentrate envelope proteins

  • Protein solubilization using mass spectrometry-compatible detergents

  • Digestion with multiple proteases to ensure comprehensive sequence coverage

  • Prefractionation of peptides using strong cation exchange chromatography

Mass Spectrometry Acquisition:

  • Nano-LC separation with extended gradients (>120 minutes)

  • Data-dependent acquisition with exclusion of high-abundance peptides

  • Parallel reaction monitoring for targeted analysis of cemA peptides

  • Multiple reaction monitoring for accurate quantification

Recent studies have demonstrated that calculating an Enrichment Factor (EF) by comparing spectral counts between purified envelope fractions and crude cellular extracts significantly improves the identification of genuine envelope proteins . This approach can distinguish between true envelope components and contaminants, addressing a major challenge in chloroplast proteomics.

Data Analysis:

  • Database searching against combined Morus and contaminant databases

  • Label-free quantification to determine relative abundance

  • Manual validation of MS/MS spectra for cemA peptides

  • Integration with prediction algorithms for transmembrane domains

How can researchers optimize the heterologous expression of recombinant cemA to maintain proper folding and functionality?

Optimizing heterologous expression of recombinant cemA requires careful consideration of multiple factors to ensure proper folding and functionality:

Expression System Selection:

  • E. coli: BL21(DE3) derivatives specialized for membrane proteins

  • Yeast: Pichia pastoris for eukaryotic post-translational processing

  • Insect cells: High-level expression of complex membrane proteins

Construct Design:

  • Codon optimization for the selected expression host

  • Fusion tags that enhance solubility (MBP, SUMO)

  • Cleavable purification tags (His, Strep) with optimized linkers

  • Signal sequences directing to appropriate membranes

Expression Conditions:

  • Reduced temperature (16-20°C) to slow protein synthesis

  • Controlled induction using lower inducer concentrations

  • Addition of chemical chaperones (glycerol, arginine)

  • Supplementation with lipids mimicking chloroplast membranes

A systematic approach comparing multiple expression conditions is recommended, with small-scale expression tests before scaling up. Functional assays should be developed to evaluate protein activity following purification, as high yield does not necessarily correlate with proper folding and function.

What functional assays can verify the activity of recombinant cemA after purification?

Verifying the functional integrity of recombinant cemA after purification requires assays that assess its native activities. While specific assays for M. indica cemA would depend on its precise functions, several approaches can be adapted:

Membrane Incorporation Assays:

  • Reconstitution into liposomes or nanodiscs

  • Assessment of proper folding using circular dichroism spectroscopy

  • Thermal stability assays using differential scanning fluorimetry

Transport Assays:

  • Proteoliposome-based transport studies with radioactive or fluorescent substrates

  • Membrane potential measurements using voltage-sensitive dyes

  • Patch-clamp electrophysiology for channel activity characterization

Interaction Studies:

  • Pull-down assays with potential interaction partners

  • Surface plasmon resonance for binding kinetics

  • Crosslinking followed by mass spectrometry for interaction mapping

When designing functional assays, researchers should consider the physiological conditions of the chloroplast envelope, including pH, ion composition, and membrane lipid environment. Control experiments with known inactive mutants (e.g., substrate-binding site mutations) should be included to validate assay specificity.

How might understanding cemA function contribute to enhancing bioactive compound production in Morus species?

Understanding cemA function in Morus species could provide insights into chloroplast membrane dynamics that influence bioactive compound production. Chloroplast envelope proteins regulate metabolite transport and are integral to biosynthetic pathways of various secondary metabolites. Research strategies to explore this connection include:

Metabolic Engineering Approaches:

  • Modulation of cemA expression to alter chloroplast-cytosol metabolite exchange

  • Analysis of resulting changes in bioactive compound profiles

  • Correlation of cemA variants with MDAAs production across Morus varieties

Comparative Studies:

  • Analysis of cemA sequence and expression between high and low bioactive-producing Morus varieties

  • Correlation of chloroplast membrane composition with medicinal properties

  • Investigation of stress-induced changes in cemA function and secondary metabolism

Research has demonstrated that Morus alba extracts contain multiple bioactive compounds with significant anti-infective properties, including potent activity against influenza viruses and pneumococcal infections . The mulberry-derived component mulberrofuran G (MG) has also shown promising activity against SARS-CoV-2 by blocking spike protein binding to ACE2 receptors . Understanding how chloroplast envelope proteins like cemA contribute to the biosynthesis and accumulation of these compounds could lead to optimized production systems.

What role might cemA play in the stress response of Morus species, particularly in pathogen resistance?

The potential role of cemA in stress responses and pathogen resistance of Morus species represents an emerging research area with significant implications. Chloroplast envelope proteins serve as crucial interfaces in plant-pathogen interactions through several mechanisms:

Signal Transduction:

  • Sensing environmental and pathogen-derived signals

  • Transmitting signals to activate appropriate defense responses

  • Modulating redox status during infection

Metabolite Transport:

  • Regulating the flow of defense compounds between compartments

  • Facilitating the export of signaling molecules

  • Controlling ion homeostasis during stress conditions

Research from Morus alba has demonstrated significant antiviral properties against various pathogens, including influenza virus and SARS-CoV-2 . For example, M. alba extracts containing over 20% MDAAs (mulberry Diels-Alder adducts) exhibited dual anti-influenza and antipneumococcal activity . Additionally, mulberrofuran G from M. alba effectively blocked SARS-CoV-2 spike protein binding to ACE2 receptors with an IC50 of 10.23 μM .

CompoundTarget PathogenIC50 ValueMechanism of Action
M. alba extracts (>20% MDAAs)Influenza virus-Viral neuraminidase inhibition
Mulberrofuran GSARS-CoV-210.23 μMBlocking spike S1 RBD:ACE2 interaction
Kuwanon G'-Me etherPneumococcal NA2.18 μMEnzyme inhibition

Investigating cemA's potential role in the biosynthesis or transport of these bioactive compounds could reveal new approaches to enhance the natural defense capabilities of Morus species.

What emerging technologies could advance our understanding of cemA structure and interactions in the chloroplast envelope?

Several cutting-edge technologies are poised to revolutionize our understanding of chloroplast envelope membrane proteins like cemA:

Structural Biology Approaches:

  • Cryo-electron microscopy for membrane protein structures without crystallization

  • Integrative structural biology combining multiple data sources

  • Hydrogen-deuterium exchange mass spectrometry for dynamics and interactions

  • Single-particle analysis for conformational states

Advanced Imaging:

  • Super-resolution microscopy to visualize membrane protein organization

  • Correlative light and electron microscopy for in situ structural studies

  • Expansion microscopy to resolve chloroplast membrane architecture

  • Live-cell imaging with genetically encoded sensors

Systems Biology Integration:

  • Multi-omics approaches combining proteomics, lipidomics, and metabolomics

  • Machine learning algorithms to predict protein-protein interactions

  • Network analysis of chloroplast envelope interactome

  • Genome-scale metabolic models incorporating envelope transport functions

Recent proteomics approaches have significantly advanced the identification of chloroplast envelope proteins by applying enrichment factor calculations that distinguish genuine envelope components from contaminants . Similar quantitative approaches could be applied to Morus species to comprehensively catalog chloroplast envelope proteins, including cemA variants.

How might genetic engineering of cemA improve desired traits in Morus species?

Genetic engineering of cemA in Morus species represents a promising approach to enhance valuable traits for both agricultural and pharmaceutical applications:

Potential Engineering Targets:

  • Modified cemA expression levels to optimize chloroplast function

  • Structure-guided mutations to enhance specific activities

  • Chimeric constructs incorporating functional domains from other species

  • Tissue-specific expression to localize effects

Expected Outcomes and Applications:

  • Enhanced biosynthesis of bioactive compounds for pharmaceutical applications

  • Improved photosynthetic efficiency and stress tolerance

  • Altered metabolite transport affecting growth characteristics

  • Optimized production of compounds with antiviral activity

Studies on Morus alba have identified multiple compounds with significant bioactive properties, including anti-influenza, antipneumococcal, and anti-SARS-CoV-2 activities . Engineering approaches targeting cemA could potentially enhance the production of these valuable compounds. For example, mulberrofuran G has shown potent inhibition of SARS-CoV-2 spike protein binding to ACE2 receptors with high binding affinity (KD = 0.119 μM for spike S1 RBD and 0.225 μM for ACE2 receptor) .

What computational approaches can predict cemA interactions with other chloroplast proteins and metabolites?

Advanced computational approaches offer powerful tools for predicting cemA interactions with other proteins and metabolites in the chloroplast environment:

Protein-Protein Interaction Prediction:

  • Sequence-based approaches using co-evolution analysis

  • Structure-based docking with homology models

  • Machine learning algorithms trained on known chloroplast interactomes

  • Network-based predictions incorporating co-expression data

Protein-Metabolite Interaction Prediction:

  • Molecular docking of potential substrates to predicted binding sites

  • Pharmacophore modeling based on known ligands

  • Molecular dynamics simulations to assess binding stability

  • Quantum mechanical calculations for transition states

Implementation Strategy:

  • Begin with homology modeling of cemA based on related proteins

  • Validate model quality using energy minimization and Ramachandran plots

  • Identify potential binding pockets using cavity detection algorithms

  • Screen metabolite libraries focusing on chloroplast-relevant compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.