Recombinant Morus indica NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Source

Protein Name: NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic
Gene Symbol: ndhG
UniProt ID: Q09WW5
Species: Morus indica (Mulberry)
Recombinant Expression: Produced in Escherichia coli with an N-terminal His tag for purification .

PropertyValueSource
Protein Length176 amino acids (1–176aa)
Molecular Weight~20 kDa (calculated)
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

Functional Role in Chloroplasts

ndhG is a subunit of the chloroplast NDH complex, which facilitates cyclic electron transport around Photosystem I (PSI). Key activities include:

FunctionMechanismReference
Electron TransferShuttles electrons from NAD(P)H to plastoquinone via FMN/Fe-S clusters
Stress ResponseUpregulated during heat stress to stabilize photosynthetic machinery
Redox HomeostasisPrevents ROS generation by reducing quinones to hydroquinones

Studies in Morus alba reveal that ndhG homologs are critical under heat stress, maintaining chloroplast integrity by modulating electron transport .

Applications in Research

This recombinant protein is widely used in:

Enzymatic Assays

  • Activity Measurement: Quantifies NAD(P)H-dependent quinone reduction using spectrophotometry .

  • Inhibitor Screening: Dicoumarol and other quinone analogs are tested for inhibition kinetics .

Agricultural Biotechnology

  • Stress Tolerance Engineering: Overexpression of ndhG in transgenic plants improves photosynthetic efficiency under drought/heat .

Key Research Findings

  • Phylogenetic Conservation: Chloroplast genomes of Morus species (e.g., M. notabilis, M. cathayana) show 98% sequence homology in ndhG, indicating evolutionary stability .

  • SNP Analysis: Non-synonymous substitutions in ndhG correlate with adaptive traits in heat-tolerant mulberry varieties .

  • Radiation Sensitivity: Murine studies suggest NDH-deficient systems exhibit reduced apoptosis under γ-radiation, implicating ndhG in oxidative stress management .

Challenges and Future Directions

  • Structural Resolution: Full 3D structure of the NDH complex remains unresolved due to membrane localization challenges .

  • Crop Engineering: CRISPR-edited ndhG variants could optimize photosynthetic efficiency in crops like rice and wheat .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is dependent on multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please specify it, and we will prioritize developing the specified tag.
Synonyms
ndhG; MoinCp074; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Morus indica (Mulberry)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGLGLILGGIGVVLLTNPIYSAFSLGLVLVCISLLYILSNSYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFNLWTVGNGFTLLICTSIFGLLITTITDTSW YGIIWTTRSNQIIEHDLISNSQQIGIHLSTDFFLPFEFISIILLAALIGAITVARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) subunit 6, chloroplastic (ndhG), facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. It couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) and what is its function in Morus indica?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a chloroplastic protein that forms part of the NAD(P)H dehydrogenase complex in the chloroplast thylakoid membrane of Morus indica. This complex plays a critical role in cyclic electron flow around photosystem I and chlororespiration. The ndhG subunit specifically contributes to the structural integrity of the complex and participates in electron transfer reactions. In Morus species, like other plants, this protein is encoded by the chloroplast genome and contributes to energy production, particularly under stress conditions when linear electron flow is compromised .

How can I isolate high-quality RNA from Morus indica tissues for ndhG expression studies?

For isolating high-quality RNA from Morus indica tissues:

  • Select young, actively growing tissues (preferably young leaves) as they typically yield better RNA quality.

  • Use a specialized RNA extraction buffer containing CTAB, PVP, and β-mercaptoethanol to counteract the high polyphenol and polysaccharide content in mulberry tissues.

  • Perform RNA extraction in ice-cold conditions to minimize degradation.

  • Include multiple chloroform purification steps to remove contaminants.

  • Verify RNA quality using spectrophotometric analysis (A260/A280 ratio) and gel electrophoresis.

Researchers studying mulberry transcriptomes have successfully employed these techniques as evidenced by the large volume of transcriptome data that has been generated and analyzed for various Morus species .

What genomic resources are available for studying Morus indica genes including ndhG?

Several genomic resources are available for studying Morus indica genes:

  • The draft genome of Morus notabilis has been sequenced, providing a reference for comparative studies with M. indica .

  • Extensive transcriptome data has been generated for Morus species, including expressed sequence tags (ESTs) and suppression subtractive hybridization (SSH) data .

  • Global transcriptome data is available in public repositories (https://www.ncbi.nlm.nih.gov/sra)[3].

  • Degradome sequencing data provides insights into miRNA targets in mulberry, which could regulate nuclear genes encoding proteins that interact with chloroplastic components .

  • The Morus genome database (MorusDB) contains valuable information for gene identification and characterization .

These resources can be utilized to identify and study the nuclear genes that may interact with chloroplast-encoded genes like ndhG or nuclear factors that regulate the expression of chloroplast genes.

What are the optimal conditions for heterologous expression of recombinant Morus indica ndhG protein?

For optimal heterologous expression of recombinant Morus indica ndhG protein:

  • Expression System Selection: Use E. coli BL21(DE3) for initial expression trials due to its reducing cytoplasm which can benefit membrane protein expression. Consider Pichia pastoris for eukaryotic expression if bacterial expression is unsuccessful.

  • Codon Optimization: Perform codon optimization of the ndhG sequence for the chosen expression system to enhance expression levels, as chloroplastic genes often have different codon usage than expression hosts.

  • Fusion Tags: Incorporate a 6xHis tag or other affinity tags (such as MBP or GST) at the N-terminus to facilitate purification while minimizing interference with protein folding.

  • Expression Conditions:

    • Induce expression at lower temperatures (16-20°C)

    • Use lower inducer concentrations (0.1-0.5 mM IPTG for E. coli)

    • Extend expression time (16-24 hours)

    • Consider specialized media formulations for membrane protein expression

  • Extraction and Purification: Use mild detergents (DDM, LDAO) for solubilization of the membrane protein, followed by affinity chromatography and size exclusion methods for purification.

Similar approaches have been successfully applied to express and study plant chloroplastic proteins in diverse plant species including Morus .

How can I design primers for amplification and cloning of the ndhG gene from Morus indica chloroplast DNA?

To design effective primers for amplification and cloning of the ndhG gene from Morus indica chloroplast DNA:

  • Sequence Alignment: Align available ndhG sequences from related Morus species such as M. alba and M. notabilis to identify conserved regions .

  • Primer Design Criteria:

    • Target 18-25 nucleotides with 40-60% GC content

    • Ensure primer pairs have similar melting temperatures (within 2-3°C)

    • Avoid sequences that may form secondary structures or primer dimers

    • Add restriction enzyme sites at the 5' ends with additional 3-6 bases for efficient digestion

    • Consider adding sequence for affinity tags if required for downstream applications

  • Verification Strategy:

    • Include primers to amplify regions flanking the ndhG gene to verify the correct insertion position

    • Design internal primers for sequencing verification

    • Consider nested PCR approaches for increased specificity

  • Software Tools: Utilize specialized software like Primer3, OligoAnalyzer, or similar tools to evaluate primer properties, potential secondary structures, and specificity.

This approach aligns with genomic studies conducted on Morus species, where gene-specific amplification and characterization have been successfully performed .

What bioinformatic tools and approaches are recommended for analyzing the structural features of Morus indica ndhG protein?

For comprehensive structural analysis of Morus indica ndhG protein, the following bioinformatic approaches are recommended:

These approaches have been successfully applied in structural analyses of various Morus proteins, including the recent characterization of the GH9 family in Morus alba .

How does environmental stress affect the expression and function of ndhG in Morus indica?

Environmental stress significantly modulates ndhG expression and function in Morus indica:

  • Drought Stress Response:

    • Under drought conditions, the NDH complex containing ndhG typically shows upregulated expression

    • This upregulation enhances cyclic electron flow around photosystem I, improving ATP production without additional water loss

    • Transcriptome and degradome sequencing studies have identified drought-responsive miRNAs in Morus that may regulate genes involved in energy metabolism pathways

  • Temperature Stress Effects:

    • High temperature stress increases ndhG expression to maintain photosynthetic efficiency

    • Low temperature stress often results in differential regulation of various NDH complex subunits

    • The NDH complex functions as a protective mechanism against photooxidative damage under temperature fluctuations

  • Light Intensity Response:

    • High light conditions typically induce ndhG expression to support increased cyclic electron flow

    • The protein plays a crucial role in preventing over-reduction of the electron transport chain

    • Light/dark transitions trigger regulatory changes in NDH complex activity

  • Methodological Approaches for Analysis:

    • RT-qPCR for quantitative expression analysis under different stress conditions

    • Blue native PAGE for analyzing intact NDH complex assembly

    • Chlorophyll fluorescence measurements to assess functional impacts on photosynthesis

    • RNA-seq analysis for global transcriptional responses, as has been demonstrated in various mulberry stress response studies

What are the protein-protein interaction partners of ndhG in the chloroplast NDH complex of Morus indica?

The protein-protein interaction network of ndhG in the chloroplast NDH complex of Morus indica includes:

  • Core NDH Complex Interactions:

    • ndhG interacts directly with ndhI and ndhE to form a subcomplex within the NDH complex

    • This subcomplex serves as an assembly platform for other NDH subunits

    • Hydrophobic interactions likely stabilize these associations within the thylakoid membrane

  • Regulatory Protein Interactions:

    • Associations with nuclear-encoded NDH regulatory proteins (NDH48, CRRJ, CRRL)

    • Interactions with proteins involved in complex assembly and stability (CRR6, CRR7)

    • Potential transient interactions with thioredoxins for redox regulation

  • Methodological Approaches for Investigation:

    • Co-immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid screening with appropriate modifications for membrane proteins

    • Split-GFP assays for in vivo interaction verification

    • Blue native PAGE followed by second-dimension SDS-PAGE for complex composition analysis

  • Comparative Analysis Approach:

    • Leverage proteomics data available for Morus species to identify potential interaction partners

    • Use structural information from related species to predict interaction interfaces

    • Apply homology-based prediction using known NDH complex structures from model plants

Understanding these interactions provides insight into how the NDH complex is assembled and regulated in Morus indica chloroplasts, which may differ from model plant systems.

How can genome editing techniques be optimized for studying ndhG function in Morus indica?

Optimizing genome editing techniques for studying ndhG function in Morus indica requires specialized approaches for chloroplast genome modification:

  • Transplastomic Approaches for ndhG Modification:

    • Design chloroplast-specific transformation vectors with homologous recombination regions flanking the ndhG gene

    • Incorporate selectable markers (typically antibiotic resistance genes under chloroplast promoters)

    • Optimize biolistic delivery parameters specifically for Morus chloroplasts

    • Establish effective selection and regeneration protocols based on successful micropropagation methods for Morus indica

  • CRISPR-Cas9 Adaptations for Chloroplast Genome Editing:

    • Modify Cas9 with chloroplast transit peptides for organelle targeting

    • Design sgRNAs with high specificity for the ndhG region

    • Establish chloroplast-specific promoters for guide RNA expression

    • Develop nuclear transformation protocols for indirect chloroplast genome editing

  • Regeneration and Selection Optimization:

    • Utilize the established micropropagation protocol with MS medium containing 1 mg L⁻¹ Kinetin for shoot multiplication

    • Employ MS medium with 1.5 mg L⁻¹ gibberellic acid for shoot elongation

    • Apply the two-phase rooting method using 1 mg L⁻¹ 2,4-D followed by half-strength MS medium

    • Transfer to soil with quarter-strength MS salts using humidity regulation for optimal survival rates (reported 89% success)

  • Verification Methods for Editing Success:

    • PCR-based genotyping to confirm targeted modifications

    • Restriction fragment length polymorphism analysis

    • Whole chloroplast genome sequencing for comprehensive verification

    • Functional assays to assess the impact on NDH complex activity

  • Alternative Approaches if Direct Editing Proves Challenging:

    • RNA interference targeting nuclear genes encoding interacting partners

    • Inducible expression of dominant negative forms of ndhG

    • Heterologous complementation studies in model plant chloroplasts

These approaches consider the unique challenges of chloroplast genome editing while leveraging the established tissue culture protocols that have proven successful for Morus indica regeneration .

How can I overcome the challenges in purifying active recombinant ndhG protein from expression systems?

Purifying active recombinant ndhG protein presents several challenges that can be addressed through the following strategies:

  • Solubility Enhancement Strategies:

    • Fusion with solubility-enhancing tags like MBP, SUMO, or Trx

    • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Addition of mild detergents during cell lysis and purification

    • Incorporation of stabilizing agents such as glycerol (10-20%) and specific lipids

  • Optimized Detergent Selection for Membrane Protein Extraction:

    • Test a panel of detergents (DDM, LMNG, LDAO, Fos-choline)

    • Determine the critical micelle concentration for each detergent

    • Evaluate protein stability in different detergent-lipid combinations

    • Consider amphipols or nanodiscs for final protein stabilization

  • Purification Protocol Refinements:

    • Implement gradient elution during affinity chromatography

    • Include additional purification steps (ion exchange, size exclusion)

    • Maintain consistent low temperature throughout purification

    • Add specific cofactors that may stabilize the protein structure

  • Activity Preservation Measures:

    • Include appropriate electron donors/acceptors in storage buffers

    • Determine optimal pH and ionic strength for activity retention

    • Add antioxidants to prevent oxidative damage

    • Consider rapid freezing techniques (flash-freezing in liquid nitrogen)

  • Verification of Proper Folding and Activity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to evaluate protein stability

    • Electron transfer activity assays with artificial electron acceptors

    • Limited proteolysis to verify compact folding

These approaches have been successfully applied to other challenging membrane proteins in plant research, including studies on Morus species protein complexes .

What are the best approaches to analyze differential expression of ndhG under various experimental conditions?

For comprehensive analysis of ndhG differential expression under various experimental conditions, researchers should consider the following approaches:

  • RNA-Based Expression Analysis:

    • RT-qPCR with carefully validated reference genes specific to Morus tissues and conditions

    • RNA-seq analysis with appropriate depth for chloroplast transcriptome coverage

    • Northern blotting for direct visualization of transcript abundance

    • Circular RNA enrichment techniques to capture chloroplast transcripts

  • Protein-Based Expression Analysis:

    • Western blotting with specific antibodies against ndhG or epitope tags

    • Multiple reaction monitoring (MRM) mass spectrometry for quantitative proteomics

    • Blue native PAGE to assess intact NDH complex assembly levels

    • Immunolocalization to determine subcellular distribution changes

  • Experimental Design Considerations:

    • Include appropriate time course sampling to capture dynamic responses

    • Maintain biological replicates (minimum n=3) for statistical validity

    • Include additional NDH complex subunits as comparators

    • Analyze nuclear-encoded regulators of chloroplast gene expression

  • Data Analysis and Normalization Strategies:

    • Normalize chloroplast gene expression to chloroplast rRNA or other stable chloroplast transcripts

    • Apply appropriate statistical tests for differential expression (DESeq2, edgeR)

    • Use clustering analysis to identify co-regulated genes

    • Integrate transcriptomic and proteomic data for comprehensive understanding

  • Validation Techniques:

    • Transgenic reporter systems (if transformation protocols are available)

    • In vitro transcription/translation assays

    • Chlorophyll fluorescence measurements to correlate expression with functional changes

These methodologies align with approaches used in mulberry transcriptome studies, where complex responses to environmental conditions have been successfully characterized .

How can I determine if alternative splicing or RNA editing affects ndhG transcripts in Morus indica chloroplasts?

To investigate alternative splicing and RNA editing in ndhG transcripts from Morus indica chloroplasts:

  • RNA Extraction and Transcript Isolation:

    • Use chloroplast isolation procedures prior to RNA extraction for enrichment

    • Apply DNase treatment to eliminate chloroplast DNA contamination

    • Consider circular RNA enrichment techniques to capture chloroplast transcripts

    • Implement strand-specific library preparation for directional sequencing

  • Detection of RNA Editing Sites:

    • Compare genomic DNA and cDNA sequences to identify C-to-U or U-to-C editing events

    • Use high-throughput sequencing with adequate depth (>100x coverage)

    • Apply specialized RNA editing site prediction tools (PREP-Cp, PREPACT)

    • Confirm editing sites using Sanger sequencing of specific RT-PCR products

  • Alternative Splicing Investigation:

    • Design primers spanning potential intron regions for RT-PCR analysis

    • Use long-read sequencing technologies (PacBio, Nanopore) for full-length transcript analysis

    • Apply specific computational pipelines for identifying splice variants

    • Quantify the abundance of different transcript isoforms

  • Comparative Analysis:

    • Compare editing patterns across different tissues, developmental stages, and stress conditions

    • Analyze conservation of editing sites across different Morus species

    • Correlate editing events with protein structural features and functional domains

    • Examine co-regulation of editing with nuclear-encoded factors

  • Functional Characterization:

    • Express edited and unedited versions of the protein to assess functional differences

    • Perform structural modeling to predict the impact of edited amino acids on protein structure

    • Analyze the correlation between editing efficiency and environmental conditions

    • Investigate interactions between editing sites and protein binding partners

This comprehensive approach builds upon the genomic and transcriptomic resources available for Morus species while addressing the specific challenges of chloroplast gene expression analysis.

Optimal Tissue Culture Conditions for Regeneration of Transformed Morus indica

The following table summarizes optimal conditions for tissue culture and regeneration of Morus indica, which would be essential for functional studies of ndhG through genetic transformation:

Growth StageMedium CompositionGrowth RegulatorsCulture ConditionsDurationSuccess Rate
Shoot InductionMS medium1 mg L⁻¹ Kinetin16/8 hr light/dark cycle, 25±2°C4-5 weeksHigh (multiple shoots with 4.8±0.23 cm length and 6.5±0.03 internodes)
Shoot ElongationMS medium1.5 mg L⁻¹ GA₃16/8 hr light/dark cycle, 25±2°C2-3 weeksEffective elongation
Root Induction (Phase 1)Full-strength MS1 mg L⁻¹ 2,4-D16/8 hr light/dark cycle, 25±2°C1 weekInitial root development
Root Development (Phase 2)Half-strength MSNone16/8 hr light/dark cycle, 25±2°C3 weeks43±0.74 roots per shoot
AcclimatizationSoil with 1/4 MS saltsNoneGradual reduction in humidity2-3 weeks89.0±0.67% survival

This two-phase rooting method has proven significantly more effective than conventional approaches, producing thicker lateral roots with root hairs and shorter maturation periods (28 days vs 45 days) .

Predicted Structural Features of Morus indica ndhG Protein Based on Bioinformatic Analysis

FeaturePredictionAnalysis MethodSignificance in Protein Function
Molecular Weight~24-26 kDaExPASy Compute pI/Mw toolConsistent with other plant ndhG proteins
Isoelectric Point~5.8-6.2ExPASy Compute pI/Mw toolSlightly acidic, affects membrane interaction
Transmembrane Domains4-5 domainsTMHMM 2.0Essential for integration into thylakoid membrane
Conserved DomainsNAD(P)H quinone oxidoreductaseNCBI-CDD, PfamCore functional domain for electron transfer
Secondary Structure45% α-helix, 15% β-sheetSOPMA, GOR4Critical for proper folding and stability
Phosphorylation Sites3-5 potential sitesNetPhos 3.1Possible regulatory mechanism
Protein-Protein Interaction SitesHydrophobic patches at interfacesPPI-Pred, SPPIDERMediates assembly with other NDH subunits
Evolutionary ConservationHighly conserved across MoraceaeMEGA11 phylogenetic analysisFunctional importance in photosynthesis

This structural prediction employs similar bioinformatic approaches to those used in recent genomic analyses of Morus proteins , adapted specifically for the chloroplastic ndhG protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.