Recombinant Morus indica Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The psbA protein is a core component of the PSII reaction center, facilitating light-driven electron transfer:

  • Light-Dependent Redox Reactions: Coordinates the oxidation of water to oxygen and the reduction of plastoquinone (PQ) to plastoquinol (PQH₂) ( ).

  • Herbicide Target: Serves as a binding site for PSII inhibitors like atrazine and diuron, which block electron transport ( ).

  • D1 Protein Turnover: Under high light stress, the D1 protein undergoes rapid turnover and replacement to prevent photodamage, a process regulated by environmental cues in cyanobacteria and plants ( ).

In mulberry (Morus alba), psbA expression is sensitive to magnesium (Mg²⁺) deficiency, as shown in transcriptomic studies where Mg-limiting conditions downregulate psbA alongside other PSII genes ( ).

Transcriptomic Insights in Mulberry

Studies on Morus alba reveal psbA downregulation under Mg-deficient conditions, highlighting its role in stress responses:

ConditionEffect on psbAImplication
Mg Deficiency (T2)Significant downregulationReduced PSII efficiency, impaired photosynthetic capacity ( ).
Low Mg (T5)Upregulation in recoveryCompensation for Mg toxicity, suggesting regulatory plasticity in PSII genes.

These findings underscore the protein’s sensitivity to nutrient availability and its role in optimizing photosynthetic performance under stress.

Recombinant Applications

The recombinant Morus indica psbA protein is utilized in:

  • ELISA Kits: For detecting psbA levels in plant tissues, enabling studies on herbicide resistance or stress responses ( ).

  • Structural Studies: To map interactions with herbicides or electron carriers, leveraging its full-length sequence ( ).

Comparative Analysis with Other Organisms

While Morus indica psbA shares homology with cyanobacterial psbA isoforms (e.g., Synechococcus D1:1 and D1:2), key differences exist:

OrganismpsbA IsoformsLight-Response Regulation
Synechococcus 7942psbAI, psbAII, psbAIIID1:1 (psbAI) dominates under low light; D1:2 (psbAII/III) replaces D1:1 under high light ( ).
Morus indicaSingle psbAExpression regulated by Mg availability, not light intensity ( ).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate this to us, and we will prioritize developing the specified tag.
Synonyms
psbA; MoinCp001; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Morus indica (Mulberry)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, producing O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that transforms photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Photosystem Q(B) protein (psbA) in Morus indica?

The Photosystem Q(B) protein (psbA) in Morus indica is a 32 kDa thylakoid membrane protein that functions as a core component of Photosystem II with an enzyme classification of EC 1.10.3.9 . The protein consists of 344 amino acids with a full sequence beginning with MTAILERRESESLWGR and ending with NAHNFPLDLA . Functionally, it plays a critical role in the photosynthetic electron transport chain, specifically in the water-splitting and oxygen-evolving processes within Photosystem II.

The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane, with specific regions responsible for binding cofactors necessary for photosynthetic electron transport. Research examining this protein commonly focuses on its role in maintaining photosynthetic efficiency under various environmental conditions.

How does the recombinant psbA protein differ from the native form?

Recombinant Morus indica psbA protein is produced through heterologous expression systems rather than being extracted directly from plant material. The recombinant form typically includes a tag (though the specific tag type is determined during the production process) . When working with the recombinant protein, researchers should consider:

  • Potential differences in post-translational modifications between recombinant and native forms

  • The influence of the expression system on protein folding and activity

  • Effects of the tag on protein structure and function

Methodologically, comparative analyses between native and recombinant forms typically employ circular dichroism spectroscopy, fluorescence spectroscopy, and activity assays to assess functional equivalence.

What are the optimal storage and handling conditions for recombinant psbA?

Based on manufacturer specifications, recombinant Morus indica psbA should be stored in Tris-based buffer with 50% glycerol at -20°C for regular storage, or at -80°C for extended storage periods . For working with the protein:

  • Prepare working aliquots and store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • When thawing, keep the protein on ice and centrifuge briefly before opening the tube

  • Use sterile techniques when handling to prevent contamination

These conditions optimize protein stability while preventing degradation that could interfere with experimental results.

What expression systems are most effective for producing recombinant Morus indica psbA?

While the search results don't specify the optimal expression system, membrane proteins like psbA typically require specialized approaches. Based on research practices with similar photosynthetic proteins:

  • Bacterial systems (E. coli): Offer high yield but may struggle with proper membrane protein folding

  • Yeast systems (P. pastoris): Better for membrane proteins due to eukaryotic processing capabilities

  • Insect cell systems: Provide good balance between yield and post-translational modifications

For Morus indica psbA specifically, expression strategies should address the hydrophobic transmembrane domains and ensure proper insertion into membranes. Co-expression with chaperones may enhance proper folding.

How can researchers verify the functional activity of recombinant psbA?

Verification of recombinant psbA activity requires multiple approaches:

  • Electron transport assays using artificial electron acceptors

  • Oxygen evolution measurements when assembled into functional Photosystem II complexes

  • Binding assays with known psbA interactors

  • Spectroscopic methods to assess cofactor binding

These assays should be performed under controlled light conditions, as psbA function is light-dependent and the protein can undergo photodamage under high light intensities.

How does psbA gene sequence vary across Morus species?

Specific to the psbA gene, which encodes the Photosystem Q(B) protein, the following substitution patterns have been observed:

SpeciesSynonymous substitutionsNon-synonymous substitutions
M. indica31
M. notabilis00
M. mongolica00
M. cathayana00
M. multicaulis00

This data indicates that M. indica shows more variation in the psbA gene compared to other Morus species, with three synonymous and one non-synonymous substitution . The limited number of non-synonymous substitutions suggests purifying selection pressure maintaining the functional constraints on this critical photosynthetic protein.

What codon usage patterns are observed in the psbA gene of Morus indica?

Codon usage analysis in Morus chloroplast genomes, including the psbA gene, reveals distinct patterns:

  • Codons ending with A and T have RSCU (Relative Synonymous Codon Usage) values greater than 1, indicating preferential usage

  • The most frequent codons contain T or A or their combinations (ATT for Ile, AAA for Lys, AAT for Asn, TTT for Phe)

  • The least frequent codons have high GC content (UGC for Cys, CGC and CGG for Arg, ACG for Thr, GCG for Ala, CCG and CCC for Pro)

The GC content analysis at each codon position revealed:

  • GC content is lower than AT content across all positions

  • GC3 (third position) content is significantly lower than GC2 and GC1 content

This codon bias appears primarily driven by nucleotide composition bias at the third position (GC3s), though selection forces may also play a role in some genes .

How can site-directed mutagenesis of psbA inform structure-function relationships?

Site-directed mutagenesis of recombinant Morus indica psbA offers valuable insights into protein function. Based on the complete amino acid sequence provided , researchers can target key functional domains:

  • Quinone binding sites: Mutations in regions interacting with plastoquinone can reveal electron transfer mechanisms

  • Metal-binding regions: Altering residues that coordinate manganese can inform about water-splitting chemistry

  • Transmembrane domains: Mutations in these regions can illuminate protein-lipid interactions

Methodologically, researchers should:

  • Design mutations based on sequence conservation analysis across species

  • Use overlap extension PCR for introducing specific mutations

  • Express both wild-type and mutant proteins under identical conditions

  • Compare biophysical properties and functional activities using spectroscopic and biochemical assays

What approaches are most effective for studying psbA turnover and repair mechanisms?

The psbA protein (D1) has one of the highest turnover rates among chloroplast proteins due to photodamage. To study its turnover and repair:

  • Pulse-chase experiments with radioactive amino acids

  • Immunoblotting with specific antibodies against different psbA epitopes

  • Fluorescent protein fusions to monitor real-time dynamics

  • Inhibitor studies to block specific steps in the repair cycle

Particularly valuable is the combination of these approaches with controlled stress conditions (high light, temperature, drought) to understand how environmental factors influence psbA turnover rates.

How do mutation patterns in psbA compare to other photosynthetic apparatus genes?

Comparative analysis of mutations across photosynthetic apparatus genes in Morus species reveals distinct patterns:

Gene categoryTotal S mutationsTotal N mutationsSelection pattern
psbA31Neutral
psaB244Negative selection in M. indica
rbcL71Positive selection in M. notabilis
ycf1814Positive selection in M. notabilis

In contrast to psaB of M. indica which shows evidence of negative selection (preserving function), psbA exhibits a more neutral evolutionary pattern . This differs significantly from genes like rbcL and ycf1 in M. notabilis which show signatures of positive selection. These differential selection pressures likely reflect varying functional constraints and adaptive requirements across the photosynthetic apparatus.

What are the implications of transition versus transversion mutations in psbA?

  • 16 A→G transitions

  • 28 T→C transitions

  • 2 A→T transversions

  • 8 A→C transversions

  • 6 T→G transversions

  • 1 G→C transversion

This predominance of transitions over transversions (44 vs 17) in M. indica is consistent with general mutation patterns. For experimental work with psbA, researchers should consider these natural mutation tendencies when designing site-directed mutagenesis studies or interpreting naturally occurring variants.

What are the major challenges in crystallizing recombinant psbA for structural studies?

Crystallizing membrane proteins like psbA presents significant challenges:

  • Detergent selection: Finding detergents that maintain protein stability while allowing crystal contacts

  • Lipid requirements: Identifying specific lipids necessary for protein function and stability

  • Protein dynamics: Managing the inherent flexibility of certain domains

  • Oxidation sensitivity: Preventing oxidation of critical residues during purification and crystallization

Methodological approaches to address these challenges include:

  • Lipidic cubic phase crystallization

  • Use of antibody fragments or nanobodies to stabilize specific conformations

  • Systematic screening of detergent and lipid combinations

  • Crystallization under anaerobic conditions to prevent oxidation

How can high-throughput approaches advance psbA research?

High-throughput approaches offer new opportunities for psbA research:

  • Massively parallel mutagenesis combined with functional selection to map protein tolerance to mutations

  • Automated protein expression and purification systems to optimize conditions

  • Microfluidic platforms for rapid screening of protein-ligand interactions

  • Machine learning approaches to predict structure-function relationships

These approaches can accelerate discovery by enabling systematic exploration of sequence-structure-function relationships in psbA, potentially revealing new insights into photosynthetic mechanisms and informing engineering efforts to enhance photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.