Recombinant Motility protein A (motA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Flagellar Motility

MotA functions as part of the stator complex (MotA₄MotB₂) in H⁺-driven flagellar motors . Key roles include:

  • Proton Channel: Facilitates H⁺ flux across the membrane, driving rotor rotation .

  • Interaction with MotB: Binds MotB via periplasmic loops to anchor the stator to the peptidoglycan layer .

  • Redundancy with MotCD: In Pseudomonas aeruginosa, MotCD proteins can compensate for MotAB in swimming motility .

Research Findings:

  • Suppression Studies: Mutations in MotB suppressing motB alleles often alter MotA’s periplasmic loops, confirming their role in stator assembly .

  • Swimming vs. Swarming: MotAB and MotCD stators exhibit distinct roles in swimming and swarming motility, respectively .

Genetic Organization and Recombinant Expression

MotA is typically co-expressed with MotB in an operon (motA-motB), where polar effects in motA deletions disrupt MotB expression . Recombinant strategies include:

  • Biobrick Construction: Fusing motA and motB under a single promoter (e.g., BBa_J23103) restores swimming in motA-deletion mutants .

  • Promoter Strength: Strong promoters (e.g., J23100) may cause toxicity, necessitating moderate expression levels .

Table 2: Promoter Efficiency in MotA Expression

PromoterStrengthOutcome
J23100StrongToxicity
J23103ModerateRescue swimming
J23106WeakPartial rescue

Antibiotic Sensitivity

  • MotB Overexpression: In Bacillus subtilis, MotB overexpression increases aminoglycoside sensitivity independent of MotA . This suggests MotB’s proton-binding site (Asp24) may alter membrane potential, enhancing drug uptake .

Biofilm Formation

  • MotA Knockouts: Disrupt flagellar motility, reducing biofilm formation in pathogens like Pseudomonas aeruginosa .

Suppression Mutations

  • MotA-MotB Interactions: Suppressor mutations in MotA (e.g., altering residues in transmembrane helices) restore motility in motB mutants, highlighting their interdependence .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
motA; Motility protein A; Chemotaxis protein MotA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Treponema phagedenis
Target Names
motA
Target Protein Sequence
MDLASFIGFFGAFAIILMGGILGGSASGFFHLPSVFITVGGSYLTLFLAYPLSYTLGIFK VCARVFKSADFHEKEIVQRLYALAEKSRRTGLLALEEEIQDFDDEFMRTGLRNVVDGIDG EAIRNLMENELSHMEERHNRWISFINAWATLAPGYGMLGTVMGLIGMLMALEDKSSLGQN MAVALVTTLYGSLMANWLLIPMATKLGLQHEAEVKSKEMIIEGVLAIQAGDHPRILAQRL LVYLNPKDKRELEAELIKD
Uniprot No.

Target Background

Function
MotA and MotB comprise the stator element of the flagellar motor complex. They are essential for the rotation of the flagellar motor. MotA is a probable transmembrane proton channel.
Protein Families
MotA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of MotA protein in bacterial systems?

MotA protein serves as a critical component of bacterial flagellar motors, particularly in Escherichia coli. It functions specifically in transmembrane proton conduction, which drives the rotation of the flagellar motor . The protein forms part of the stator complex that converts the energy from proton flow across the membrane into the mechanical energy required for bacterial motility. Understanding this function is essential for researchers investigating bacterial movement mechanisms and potential targets for antimicrobial development. The protein's role in proton channel structure has been extensively studied using techniques such as tryptophan-scanning mutagenesis, which reveals important structural features essential to its function .

How are recombinant MotA and BimA proteins expressed for research purposes?

Recombinant expression of motility proteins typically employs bacterial expression systems, most commonly using Escherichia coli as the host organism. For example, recombinant Burkholderia intracellular motility A (rBimA) protein can be expressed by cloning the gene into an expression vector such as pET28a+ and transforming it into E. coli BL21(DE3) strain . Expression is then induced using IPTG (isopropyl β-D-1-thiogalactopyranoside) at appropriate concentrations, such as 0.5 mM as demonstrated in published research . The recombinant protein typically includes a histidine tag to facilitate purification through immobilized metal affinity chromatography (IMAC). Western blot analysis with anti-His tag antibodies can be used to confirm successful expression, revealing bands at the expected molecular weight (approximately 12.2 kDa for truncated rBimA) .

What structural features of MotA have been revealed through mutagenesis studies?

Tryptophan-scanning mutagenesis has been particularly informative in revealing structural features of MotA protein. This technique involves introducing single tryptophan residues at various positions within the hydrophobic segments of the protein and measuring the effects on function . Studies have shown that function is disrupted according to a periodic pattern, suggesting that the membrane-spanning segments of MotA form alpha-helical structures . This periodic disruption pattern helps identify the lipid-facing portions of each helix. These findings support hypotheses about MotA's tertiary structure and provide insights into how the protein facilitates proton conduction across the membrane. The alpha-helical nature of these transmembrane segments is a critical structural feature that determines the protein's functionality in the flagellar motor complex .

How can Design of Experiments (DOE) methodology optimize recombinant MotA protein expression?

Optimizing recombinant MotA protein expression requires systematic experimentation that can be effectively approached using Design of Experiments (DOE) methodology. Unlike the less effective one-factor-at-a-time (OFAT) approach, DOE enables researchers to simultaneously vary multiple factors, such as temperature, induction time, media composition, and inducer concentration, to determine optimal conditions and identify factor interactions . A full factorial DOE would test all possible combinations of selected factor levels in random order to average out effects of lurking variables .

For MotA expression, researchers should:

  • Identify key factors affecting expression (e.g., temperature, IPTG concentration, induction time)

  • Define factor levels (e.g., temperatures of 25°C and 37°C)

  • Design experiments testing all combinations

  • Analyze results to build a statistical model that estimates individual effects and their interactions

  • Use prediction tools to identify optimal settings for maximum protein yield

This approach is more efficient than trial-and-error methods, requiring fewer experimental runs while providing greater insight into how factors interact to affect protein expression . Statistical analysis of DOE results will reveal which factors significantly impact MotA expression and solubility, allowing researchers to develop an optimized protocol.

What are the key considerations when designing purification protocols for recombinant MotA proteins?

Purification of recombinant MotA proteins presents specific challenges due to their membrane-associated nature and potential insolubility. Research findings indicate that recombinant motility proteins like BimA often associate with the pellet fraction during cell lysis, demonstrating their insolubility in native conditions . A comprehensive purification strategy should address these challenges through several key considerations:

  • Solubilization strategy: High-concentration denaturants (e.g., 8M urea) may be necessary to solubilize the protein from inclusion bodies or membrane fractions .

  • Purification method selection: Immobilized metal affinity chromatography (IMAC) under denaturing conditions has proven effective for His-tagged recombinant motility proteins .

  • Refolding protocol optimization: Gradual dialysis to remove denaturants while maintaining protein solubility is critical. For instance, research shows that complete removal of urea may cause protein precipitation, necessitating maintenance of residual denaturant (e.g., 1M urea) in storage buffer .

  • Buffer optimization: Storage conditions significantly impact protein stability. The published research demonstrates that purified rBimA can remain stable for 9 months at 4°C and 6 months at room temperature in appropriate buffer conditions .

  • Endotoxin removal: For diagnostic applications, endotoxin levels must be controlled (<0.25 EU/μg for rBimA) .

  • Stability assessment: Comprehensive stability testing at various temperatures is essential for determining shelf-life and storage conditions. For example, rBimA degraded after 2 months at 40°C, providing important information for storage recommendations .

How can researchers effectively analyze the structural conformation of recombinant MotA using spectroscopic techniques?

Analysis of MotA structural conformation requires combining multiple spectroscopic approaches to generate comprehensive structural data. The alpha-helical nature of MotA's transmembrane segments, as suggested by tryptophan-scanning mutagenesis , can be further characterized using:

  • Circular Dichroism (CD) Spectroscopy: This technique can quantify secondary structure content, confirming the alpha-helical composition of MotA's transmembrane domains. Researchers should collect spectra in the far-UV range (190-260 nm) using protein samples in detergent micelles or lipid nanodiscs to maintain native-like membrane environments.

  • Tryptophan Fluorescence Spectroscopy: Building upon the tryptophan-scanning mutagenesis approach , researchers can exploit the intrinsic fluorescence properties of introduced tryptophan residues. The emission maximum of tryptophan shifts based on local environment polarity, providing information about residue accessibility and membrane insertion depth.

  • Fourier Transform Infrared Spectroscopy (FTIR): This method can provide additional confirmation of alpha-helical structure in membrane environments and is particularly valuable for studying hydrogen-deuterium exchange to assess solvent accessibility of different protein regions.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For detailed structural analysis, solution NMR with isotopically labeled MotA can reveal atomic-level structural information, particularly when combined with membrane mimetics appropriate for transmembrane proteins.

  • Cross-linking Mass Spectrometry: This approach can identify spatial relationships between domains and confirm structural models derived from other techniques.

By integrating these complementary spectroscopic methods, researchers can develop a comprehensive structural model of MotA that explains its proton conductance mechanism in flagellar motor function.

How does rBimA protein function as a diagnostic tool for glanders detection?

Recombinant Burkholderia intracellular motility A (rBimA) protein serves as an effective diagnostic reagent for detecting glanders, a highly contagious and fatal equine disease caused by Burkholderia mallei . The diagnostic application functions through an indirect enzyme-linked immunosorbent assay (ELISA) format where purified rBimA protein is used to detect antibodies in equine serum samples.

The diagnostic principle relies on several key factors:

  • Unique epitopes: The amino-terminal sequence of BimA from B. mallei is highly distinctive, sharing only 14% identity with corresponding sequences from B. pseudomallei strain K96243 and even less (6%) with strain 1106a . This sequence uniqueness contributes to the high specificity of the assay.

  • Antibody recognition: During B. mallei infection, the host immune system produces antibodies against BimA. In the indirect ELISA, these antibodies bind to the recombinant BimA coated on the plate and are subsequently detected using labeled secondary antibodies.

  • Sensitivity and specificity: Research demonstrates that rBimA-based indirect ELISA achieves 100% sensitivity (detecting all 21 true-positive samples tested) and 98.88% specificity (with only 17 false positives among 1,524 potentially negative samples) . This performance exceeds traditional diagnostic methods such as complement fixation test (CFT).

  • Cross-reactivity assessment: Importantly, the rBimA protein does not cross-react with sera from melioidosis patients or healthy human controls, further confirming its diagnostic specificity .

The cutoff value for the indirect ELISA is established by testing known negative samples and calculating the mean optical density (OD) plus three standard deviations, which was determined to be 0.94 OD492 in the reported research .

What advantages does recombinant BimA offer over traditional diagnostic antigens for glanders?

Recombinant BimA provides several significant advantages over traditional crude antigens used in conventional diagnostic tests for glanders, addressing key limitations of established methods:

  • Improved specificity and sensitivity: Traditional diagnostic tests like the complement fixation test (CFT) and conventional ELISAs using crude antigens have demonstrated inconsistent results with limited sensitivity and specificity . In contrast, the rBimA-based indirect ELISA achieves 100% sensitivity and 98.88% specificity, representing a substantial improvement in diagnostic accuracy .

  • Defined composition: Unlike crude antigen preparations derived from bacterial cultures, recombinant BimA is a well-defined molecular entity with consistent composition, eliminating batch-to-batch variation that can affect test reliability .

  • Absence of cross-reactivity: The rBimA protein shows no cross-reactivity with sera from melioidosis patients or healthy human controls, indicating its high specificity for detecting B. mallei infections without false positives from related bacterial species .

  • Stability and standardization: The recombinant protein demonstrates excellent stability, remaining usable for 9 months at 4°C and 6 months at room temperature . This extended shelf-life facilitates standardization of diagnostic procedures and improves test reliability across different laboratories and geographical regions.

  • Scalable production: Expression in E. coli allows for standardized, scalable production of the diagnostic reagent, yielding approximately 20 mg of purified protein per liter of bacterial culture .

  • Simplified testing workflow: The indirect ELISA format using rBimA provides a more straightforward testing procedure compared to the technically demanding CFT method, making it more accessible for routine diagnostic use in diverse laboratory settings.

These advantages make recombinant BimA a superior diagnostic reagent for glanders detection, addressing the limitations of traditional methods while providing a more reliable and standardized approach for disease surveillance and control.

How can the MOTA framework be adapted for analyzing MotA protein research projects?

The Motivations and Abilities (MOTA) framework, although originally designed for different contexts, can be adapted as a structured approach to evaluate and plan MotA protein research projects. This application involves systematically adapting the six-step MOTA process to the specific context of MotA research:

  • Problem definition and applicability assessment:

    • Gather background information on specific MotA research questions

    • Identify relevant stakeholders (researchers, funding agencies, potential applications)

    • Define spatial and temporal scope of the research

    • Refine the final problem definition for the MotA research project

  • Specification of relevant elements:

    • Identify triggers driving the need for MotA research (e.g., antimicrobial resistance)

    • Define expected motivations for various stakeholders

    • Assess financial, institutional, technical, and social abilities required for the research

    • Visually conceptualize relationships between MotA research elements using causal relationship mapping

  • Survey preparation:

    • Design data collection methods for assessing current knowledge and research gaps

    • Develop survey instruments for gathering expert opinions on research priorities

    • Pre-test survey instruments with pilot groups

  • Implementation:

    • Conduct surveys and interviews with experts in bacterial motility

    • Ensure adequate response rates to minimize selection bias

  • Data processing and analysis:

    • Calculate MOTA scores specific to MotA research priorities

    • Map scores on a two-dimensional graph (motivation vs. ability)

    • Analyze patterns to identify high-priority research directions

  • Result synthesis and recommendations:

    • Present findings in formats useful for research planners and funding agencies

    • Provide specific recommendations for capacity building in MotA research

This adapted framework provides a structured approach to evaluate research priorities, assess stakeholder engagement, and develop strategic plans for advancing MotA protein research in bacterial motility.

What statistical approaches are most appropriate for analyzing tryptophan-scanning mutagenesis data in MotA structure studies?

Tryptophan-scanning mutagenesis studies, as employed in MotA structure research , generate complex datasets that require specialized statistical approaches for rigorous analysis. Researchers should consider implementing the following statistical methods:

By applying these statistical approaches, researchers can extract maximum structural information from tryptophan-scanning mutagenesis experiments, leading to more reliable models of MotA's transmembrane domains and their arrangement in the flagellar motor complex.

What are the most promising future directions for recombinant MotA protein research?

Future research on recombinant MotA proteins should focus on several promising directions that build upon current understanding while addressing existing knowledge gaps:

  • Structure-function relationship elucidation: Combining tryptophan-scanning mutagenesis with advanced structural biology techniques (cryo-electron microscopy, X-ray crystallography) could provide higher-resolution insights into MotA's proton channel structure. This could reveal the precise mechanism of proton translocation and energy conversion in flagellar motors.

  • Designer MotA variants: Using protein engineering approaches to create modified MotA proteins with altered conductance properties or substrate specificities could advance both fundamental understanding and biotechnological applications.

  • Comparative analysis across species: Expanding tryptophan-scanning and structural studies to MotA homologs from diverse bacterial species would reveal evolutionary conservation patterns and species-specific adaptations in flagellar motor function.

  • Integration with in silico approaches: Developing computational models of MotA function based on experimental data would allow for simulation of proton flow and prediction of the effects of mutations, facilitating hypothesis generation for experimental testing.

  • Exploitation for antimicrobial development: Further characterization of MotA structure could identify potential binding sites for small molecules that disrupt flagellar function, providing new targets for antimicrobial development against motile pathogens.

  • Diagnostic applications expansion: Building on the success of rBimA in glanders diagnosis , exploring the development of diagnostic assays based on other recombinant motility proteins could address detection needs for additional bacterial pathogens.

  • Nanomotor development: Understanding the molecular mechanisms of MotA function could inform the design of synthetic nanomotors for various biotechnological and biomedical applications.

These research directions would significantly advance understanding of bacterial motility mechanisms while potentially yielding applications in diagnostics, antimicrobial development, and nanotechnology.

How might contradictory data in MotA structural studies be reconciled through integrated analytical approaches?

Reconciling contradictory data in MotA structural studies requires implementing integrated analytical approaches that can account for methodological differences, contextual variations, and underlying biological complexity:

  • Meta-analysis of tryptophan-scanning data: Systematically comparing results from different tryptophan-scanning studies using standardized effect size measures can identify consistently supported structural features versus lab-specific or condition-specific findings.

  • Reconciliation through computational modeling: Developing computational models that can accommodate seemingly contradictory data points by incorporating contextual variables (e.g., membrane composition, pH, ion concentrations) can provide a unifying framework for understanding MotA structure under different conditions.

  • Multi-method validation: Triangulating structural information using complementary techniques (e.g., FRET spectroscopy, disulfide cross-linking, site-directed spin labeling) can provide convergent validity for structural models. When techniques yield contradictory results, examining methodological assumptions becomes crucial.

  • Functional state-specific analysis: MotA likely adopts different conformations during the proton translocation cycle. Capturing and analyzing these distinct functional states can resolve apparent contradictions that arise from studying different points in the conformational cycle.

  • Statistical filtering approaches: Developing statistical methods to identify outlier data points versus genuine structural variants can help distinguish experimental artifacts from biologically meaningful structural heterogeneity.

  • Integration with systems-level data: Incorporating information from whole-motor cryo-EM studies and functional assays of intact flagellar motors can provide contextual constraints for reconciling contradictory molecular-level data.

  • Collaborative data repositories: Establishing shared databases of raw experimental data from MotA structural studies would enable re-analysis using standardized methods, potentially resolving contradictions arising from differences in data processing.

By implementing these integrated approaches, researchers can develop more robust structural models of MotA that accommodate apparent contradictions and provide a more complete understanding of this complex transmembrane protein's structure and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.