Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (Agpat1)

Shipped with Ice Packs
In Stock

Description

Overview of AGPAT1

Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, also known as AGPAT1, is an enzyme encoded by the Agpat1 gene that plays a crucial role in lipid metabolism . Specifically, it catalyzes the conversion of lysophosphatidic acid (LPA) into phosphatidic acid (PA) . Both LPA and PA are phospholipids that participate in signal transduction and lipid biosynthesis within cells . AGPAT1 is located in the endoplasmic reticulum and is part of the 1-acylglycerol-3-phosphate O-acyltransferase family .

Synonyms

AGPAT1 is known by several other names, including :

  • 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)

  • 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha

  • LPAAT alpha

  • LPAATA

Gene Information

The Agpat1 gene is responsible for encoding the AGPAT1 enzyme . Alternative splicing of this gene results in two transcript variants that encode the same protein .

Function

AGPAT1 functions as an acyltransferase, specifically a 1-acylglycerol-3-phosphate O-acyltransferase . It plays a role in the phosphatidic acid biosynthetic process . The enzyme exhibits 1-acylglycerol-3-phosphate O-acyltransferase activity and protein binding capabilities .

4.1. Biochemical Functions

AGPAT1 has several biochemical functions, including 1-acylglycerol-3-phosphate O-acyltransferase activity and protein binding .

FunctionRelated Protein
protein bindingRAB6B, POLDIP3, MST1, RIPK1L, SPINK2, GPSM2, POLR2A, RPS3, SIRT6, RP9
1-acylglycerol-3-phosphate O-acyltransferase activityABHD5, AGPAT9L, LCLAT1, AGPAT9, AGPAT3, LYCAT, LPCAT2, AGPAT2, AGPAT4, AGPAT5

Involvement in Pathways

AGPAT1 participates in various metabolic pathways, including CDP-diacylglycerol biosynthesis, glycerophospholipid metabolism, and fatty acid metabolism .

5.1. Key Pathways Involving AGPAT1

Pathway NamePathway Related Protein
Glycerophospholipid biosynthesisPEMT, PLBD1, AWAT1, CDIPT, ABHD3, PLD6, ABHD4, STIL, CHKB, AWAT2
Glycerolipid metabolismAKR1B7, GPAT2, MOGAT3, PNLIPRP2, PPAP2C, CELL, PPAP2CB, GK, GPAM, DAK
Fatty acid, triacylglycerol, and ketone body metabolismCDK19, MED9, MED6, SIN3B, ACOT6, MMAA, CYP4A11, ACOT13, ANKRD1, SLC25A20
Fat digestion and absorptionPLA2G2F, AGPAT2, APOA1, PLA2G1B, FABP1, PPAP2B, PLA2G2D, CD36, PLA2G3, MOGAT3
CDP-diacylglycerol biosynthesis IAGPAT2
Glycerophospholipid metabolismPLA2G2E, PLA2G12B, PNPLA7, STIL, PPAP2C, PLA2G4D, PLA2G4C, LCAT, PNPLA6, PLD4
CDP-diacylglycerol biosynthesisAGPAT6, GPAT2, AGPAT2, GK5, CDS1

Interacting Proteins

AGPAT1 interacts directly with several proteins and molecules, including MEOX2, Hoxa1, and MYC . These interactions have been identified through methods such as yeast two-hybrid assays, co-immunoprecipitation, and pull-down assays .

Role as a Biomarker

AGPAT1 has been identified as a potential biomarker for differentiating between ulcerative colitis with and without primary sclerosing cholangitis (PSC-UC) . Studies using LC-MS/MS proteomics and immunohistochemistry (IHC) have shown that AGPAT1 concentrations and staining intensity differ significantly between PSC-UC and UC patients .

7.1. AGPAT1 in Colonic Biomarker Analysis

AGPAT1 is considered a potential colonic biomarker that differentiates PSC-UC from UC . In a meta-analysis, AGPAT1 had the lowest P value (3.6e-06) among 6,121 proteins, which remained significant after adjusting for multiple testing .

7.2. Immunohistochemistry (IHC) Results

IHC analysis using a validated antibody toward AGPAT1 showed general cytoplasmic staining in epithelial and inflammatory cells, with more intense staining in surface epithelial cells .

8.1. Colorectal Cancer

AGPAT1 has been acknowledged as a negative prognostic marker for colorectal cancer .

8.2. Metabolic Disorders

Agpat1 knockout mice exhibit widespread disturbances in metabolism, sperm development, and neurologic function due to disrupted phospholipid homeostasis . These mice show low body weight, low plasma glucose levels, and decreased hepatic messenger RNA expression of Igf-1 and Foxo1 .

Studies on Agpat1 Knockout Mice

Studies on Agpat1 knockout mice (Agpat1 -/-) have revealed several critical functions of AGPAT1 in various organ systems :

  • Metabolic Abnormalities: Agpat1 -/- mice exhibit low body weight, reduced body fat percentage, and decreased hepatic mRNA expression of Igf-1 and Foxo1 .

  • Reproductive Impairment: Male Agpat1 -/- mice show impaired sperm development with a late meiotic arrest, while female mice display oligoanovulation .

  • Neurological Dysfunction: Agpat1 -/- mice demonstrate abnormal hippocampal neuron development and are prone to audiogenic seizures .

9.1. Energy Expenditure in Agpat1 -/- Mice

Agpat1 -/- mice show greater locomotor activity but no significant difference in food intake or respiratory exchange ratio, making it unclear how these mice dissipate energy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Agpat1; 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; 1-acylglycerol-3-phosphate O-acyltransferase 1; 1-AGP acyltransferase 1; 1-AGPAT 1; Lysophosphatidic acid acyltransferase alpha; LPAAT-alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MELWPGAWTALLLLLLLLLSTLWFCSSSAKYFFKMAFYNGWILFLAILAIPVCAVRGRNV ENMKILRLLLLHAKYLYGIRVEVRGAHHFPPTQPYVVVSNHQSSLDLLGMMEVLPDRCVP IAKRELLWAGSAGLACWLAGIIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNH NGSMLPFKRGAFHLAVQAQVPIIPIVMSSYQDFYSKKERRFTSPGRCQVRVLPPVSTEGL TPDDVPALADSVRHSMLTIFREISTDGLGGGDCLKKPGGAGEARL
Uniprot No.

Target Background

Function

This recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha (Agpat1) catalyzes the conversion of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by adding an acyl moiety to the sn-2 position of the glycerol backbone.

Gene References Into Functions
  1. Studies using Agpat1-/- mice revealed widespread metabolic disruptions, impaired sperm development, and neurological dysfunction, all attributable to disrupted phospholipid homeostasis. These findings highlight AGPAT1's crucial role in the physiology of multiple organ systems, making the Agpat1-deficient mouse a valuable model for studying the impact of phospholipid and triacylglycerol synthesis on physiology and disease. PMID: 28973305
  2. Research suggests a significant role for AGPAT1 in skeletal muscle development, particularly in terminal differentiation, linked to the regulation of the actin cytoskeleton. PMID: 20561744
  3. Findings indicate that mitochondrial GPAT1 (mtGPAT1) may be a novel therapeutic target for hepatic steatosis and hepatic insulin resistance, suggesting that long-chain acyl-CoAs do not mediate fat-induced hepatic insulin resistance in this model. PMID: 16054099
Database Links

KEGG: mmu:55979

STRING: 10090.ENSMUSP00000048573

UniGene: Mm.8684

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the biochemical function of mouse Agpat1 in glycerolipid synthesis?

Mouse Agpat1 catalyzes the acylation of lysophosphatidic acid (LPA) to form phosphatidic acid (PA), representing a critical step in glycerophospholipid synthesis. Methodologically, this activity can be determined using enzymatic assays with radiolabeled substrates, where the conversion of LPA to PA is measured in cell lysates expressing recombinant Agpat1. The enzyme specifically transfers acyl groups from acyl-CoA donors to the sn-2 position of LPA, functioning within the Kennedy pathway for phospholipid synthesis .

To assess Agpat1 enzymatic activity experimentally, researchers typically use purified recombinant protein or protein expressed via adenoviral vectors in cell culture systems. The standard assay involves incubating the enzyme with LPA and [14C]-oleoyl-CoA, followed by quantification of the radioactive PA product formed .

How does Agpat1 expression differ across mouse tissues?

Expression profiling shows Agpat1 is widely distributed across multiple mouse tissues, with significant expression in metabolically active tissues. To characterize tissue distribution, researchers employ quantitative real-time PCR with specific primers targeting Agpat1 mRNA. The methodology involves calculating ΔCt values between the Agpat1 Ct and G3PDH (housekeeping gene) Ct for each tissue sample to allow for standardized comparison across tissues .

Protein expression validation requires Western blot analysis using validated antibodies against Agpat1, with total cell lysates (approximately 40 μg) separated using SDS-PAGE techniques. Immunohistochemistry (IHC) can additionally provide spatial information about protein localization within specific tissue regions .

What phenotypes are observed in Agpat1-deficient mouse models?

Agpat1-deficient (Agpat1-/-) mice show altered lipid metabolism characterized by decreased tissue triacylglycerol (TAG) content, particularly in the liver. When challenged with high-fat diets, these mice display complex metabolic responses. After short-term high-fat feeding (1-3 weeks), Agpat1-/- mice demonstrate improved glucose tolerance and protection from hepatic insulin resistance, suggesting a beneficial metabolic adaptation .

Methodologically, glucose tolerance in these models is assessed using intraperitoneal glucose tolerance tests, while insulin sensitivity can be evaluated using hyperinsulinemic-euglycemic clamp techniques. The improved glucose metabolism in short-term studies correlates with reduced hepatic diacylglycerol (DAG) content and lower activation of protein kinase C (PKC) isoforms implicated in insulin resistance .

Interestingly, longer-term high-fat feeding (4 months) leads to paradoxical results, with Agpat1-/- mice developing more severe glucose intolerance and hyperinsulinemia compared to wild-type controls. This temporal difference highlights the complex compensatory mechanisms operating in chronic metabolic stress conditions and underscores the importance of experimental duration in metabolic phenotyping .

What are the optimal methodologies for measuring Agpat1 enzymatic activity?

The gold standard for measuring mouse Agpat1 activity involves a dual-substrate radiometric assay. The optimized protocol includes:

  • Cell lysate preparation: Harvesting cells 48 hours post-infection with recombinant Agpat1 adenovirus (MOI ≥150), washing with PBS, and homogenization in buffer containing 250 mM sucrose, 10 mM Tris-HCl (pH 7.4), and 1 mM EDTA with protease inhibitors .

  • Enzyme reaction assembly: Combining 60 μM acyl-CoA (typically oleoyl-CoA) with 150-80 μM LPA substrate in a reaction buffer containing 75 mM Tris-HCl (pH 7.5), 4 mM MgCl2, 1 mg/ml BSA, 8 mM NaF, 1 mM DTT, and either [14C]-oleoyl-CoA or LPA with radiolabeled acyl groups .

  • Product detection: Following incubation (typically 10 minutes at 37°C), reactions are terminated with chloroform:methanol (2:1), and the lipid phase is isolated. Radiolabeled products are separated by thin-layer chromatography and quantified by scintillation counting .

To ensure specificity, control experiments using lysates from cells expressing β-galactosidase should be performed in parallel. Additionally, validation requires demonstrating linear reaction kinetics with respect to protein concentration and time .

How can researchers effectively generate and validate Agpat1 overexpression models?

Generating reliable Agpat1 overexpression models requires careful design and validation:

  • Vector construction: For adenoviral expression, the cDNA encoding full-length mouse Agpat1 should be cloned into a shuttle vector (e.g., pShuttle-CMV) with verification of sequence integrity and orientation. Recombinant adenovirus is then generated through co-transfection with an adenoviral backbone vector (e.g., pAdEasy-1) in HEK-293 cells .

  • Expression validation: Multiple viral pools should be tested for enzymatic activity, with the most active pools selected for further amplification and purification. Western blot analysis using epitope tag-specific or Agpat1-specific antibodies confirms protein expression. Expected band size for mouse Agpat1 is approximately 32 kDa .

  • Functional validation: Enzymatic activity measurements comparing overexpressing cells to control cells should demonstrate at least 2-3 fold higher AGPAT activity. Changes in cellular lipid composition, particularly increased phosphatidic acid and downstream lipids, should be documented using lipidomic approaches .

In vivo overexpression models (using adenoviral delivery to mouse liver) require additional validation of tissue-specific expression and phenotypic characterization, including:

  • Hepatic acyl-CoA content measurement

  • Plasma β-hydroxybutyrate quantification for fatty acid oxidation assessment

  • Glucose and insulin tolerance testing

  • Tissue triacylglycerol quantification

How do Agpat1 manipulations affect insulin signaling and glucose metabolism?

Agpat1 manipulations have significant impacts on insulin signaling pathways, particularly through altering the cellular lipid intermediate profile. The methodological approach to studying these effects includes:

  • In vivo insulin signaling assessment: Following Agpat1 overexpression or knockdown, researchers should perform hyperinsulinemic-euglycemic clamp studies to measure hepatic glucose output, peripheral glucose uptake, and hepatic glycogen synthesis. These parameters directly reflect tissue-specific insulin sensitivity .

  • Signaling protein activation analysis: Western blotting for phosphorylated Akt (Ser473) and other insulin signaling intermediates should be performed in tissue lysates collected after in vivo insulin administration. GPAT1 overexpression is associated with activation of PKCε, which can be assessed by membrane translocation assays .

  • Glucose metabolism measurements: 2-deoxyglucose uptake assays in isolated tissues provide direct measurement of insulin-stimulated glucose transport. Research indicates that AGPAT1 overexpression can increase insulin-stimulated glucose uptake by >50% and enhance conversion to lipid by 85% .

Key experimental findings demonstrate that Agpat1 alterations affect insulin sensitivity in a tissue-specific and time-dependent manner. In GPAT1-overexpressing rats, both hepatic and whole-body insulin resistance develop, with 40% lower glucose infusion rates during clamp studies, 22% lower hepatic glycogen synthesis, and 2.5-fold higher hepatic glucose output. Additionally, these animals show reduced muscle glucose uptake and glycogen incorporation despite increased TAG accumulation .

What proteomic approaches are most effective for studying Agpat1 in disease models?

Advanced proteomic approaches offer powerful tools for investigating Agpat1 in disease contexts:

  • Mass spectrometry-based quantification: LC-MS/MS analysis of tissue lysates processed using multienzyme digestion filter-aided sample preparation (FASP) represents the gold standard approach. This methodology allows for unbiased, high-resolution protein quantification using tryptophan fluorescence assays to standardize protein input .

  • FFPE tissue proteomics: For archived specimens, formalin-fixed paraffin-embedded (FFPE) tissue proteomics enables retrospective analysis. The protocol involves deparaffinization, protein extraction, enzymatic digestion with endoproteinase LysC and trypsin, followed by LC-MS/MS analysis on instruments such as QExactive (Thermo) .

  • Data analysis: Raw spectral intensities from MaxQuant output can be used to calculate protein titers using the "total protein approach." For comparative studies, statistical analysis should include both individual cohort comparisons and meta-analysis across multiple proteomic datasets .

Recent research demonstrates the utility of these approaches in identifying AGPAT1 as a disease biomarker. In a study examining inflammatory bowel disease, AGPAT1 was identified as a potential discriminating marker between ulcerative colitis (UC) and primary sclerosing cholangitis-associated UC (PSC-UC). The proteomic findings were further validated using immunohistochemistry with automated image analysis, providing a complementary approach for clinical translation .

ProteinUniProt IDDiscovery CohortValidation CohortValidated
Mean diffP value, t-testMean diffP value, t-test
AGPAT1Q99943-0.3320.0007-0.2140.0094Yes

Table: Statistical validation of AGPAT1 as a biomarker across discovery and validation cohorts .

What techniques are most effective for visualizing and quantifying Agpat1 in tissue samples?

Optimized techniques for Agpat1 visualization and quantification in tissue samples include:

The application of these techniques has demonstrated that AGPAT1 expression levels can distinguish between disease phenotypes, with PSC-UC samples showing significantly higher proportions of strong AGPAT1 staining compared to UC alone. This highlights the potential of combining routine imaging technologies with artificial intelligence-based scoring for biomarker applications .

How does Agpat1 contribute to hepatic fat metabolism and insulin resistance?

Agpat1/GPAT1 plays a central role in hepatic fat metabolism with significant implications for insulin resistance research. Methodological investigations reveal:

  • Impact on fatty acid partitioning: GPAT1 directs acyl-CoAs toward glycerolipid synthesis and away from β-oxidation. In GPAT1-deficient mice, hepatic fatty acid oxidation increases, as evidenced by reduced hepatic triacylglycerol content and elevated hepatic acyl-CoA levels. This metabolic shift can be experimentally quantified by measuring plasma β-hydroxybutyrate concentrations and ex vivo tissue oxidation rates .

  • Effects on reactive oxygen species: The enhanced β-oxidation in Gpat1-/- mice results in a 20% increase in mitochondrial reactive oxygen species production and increased sensitivity to mitochondrial permeability transition, indicating mitochondrial dysfunction. These parameters should be assessed using isolated mitochondria and appropriate fluorescent probes for ROS detection .

  • Insulin signaling: GPAT1 overexpression in rat liver activates PKCε without evidence of inflammation, supporting the hypothesis that elevated DAG levels directly contribute to insulin resistance. This can be experimentally assessed through membrane translocation assays for PKC isoforms and phosphorylation status of insulin receptor substrates .

The mechanistic link between Agpat1/GPAT1 activity and insulin resistance involves altered DAG accumulation, which affects insulin signaling through PKC activation. This relationship provides important insights for developing targeted interventions for metabolic disorders .

What are the contradictions in literature regarding Agpat1 metabolic effects?

Several notable contradictions exist in the Agpat1 literature, requiring careful experimental design and interpretation:

To address these contradictions, researchers should implement comprehensive experimental designs that:

  • Include multiple time points for metabolic challenge studies

  • Assess multiple tissues simultaneously

  • Employ both loss-of-function and gain-of-function approaches

  • Validate enzymatic activities using multiple methodological approaches

How can Agpat1 research contribute to understanding inflammatory conditions?

Recent proteomic studies have revealed unexpected connections between Agpat1 and inflammatory conditions:

  • Biomarker potential: AGPAT1 has emerged as a novel colonic biomarker capable of distinguishing between ulcerative colitis (UC) and primary sclerosing cholangitis-associated UC (PSC-UC). This finding was identified through unbiased LC-MS/MS proteomic analysis and successfully validated in independent cohorts .

  • Experimental approach: The methodology involves systematic proteomic comparison of disease tissues using a two-step discovery and validation approach. The complete workflow includes:

    • Initial discovery using full proteome comparison

    • Candidate biomarker selection based on statistical significance

    • Validation in an independent cohort using the same methodology

    • Meta-analysis combining multiple proteomic datasets

    • Orthogonal validation using IHC with digital pathology quantification

  • Mechanistic implications: AGPAT1's role in lipid metabolism may connect to inflammatory pathways through bioactive lipid mediators. There is growing interest in lipid metabolism as an actor in immune regulation and as a potential target for biomarker discovery in inflammatory bowel disease .

Additionally, AGPAT1 has been acknowledged as a negative prognostic marker for colorectal cancer outcomes, suggesting potential connections between altered lipid metabolism, chronic inflammation, and cancer development that warrant further investigation .

What knockdown strategies are most effective for studying Agpat1 function?

Several knockdown approaches have been validated for studying Agpat1 function:

  • shRNA-mediated knockdown: Adenoviral delivery of shRNA targeting specific Agpat1 sequences has proven effective for acute knockdown in cell culture and in vivo. For hepatic knockdown in mouse models, adenoviral shRNA delivery has successfully reduced GPAT1 expression in ob/ob mice, resulting in reduced hepatic TAG and DAG content .

  • Genetic knockout models: Complete Agpat1/GPAT1 knockout mice (Gpat1-/-) represent the gold standard for long-term functional studies. These models allow assessment of compensation by related family members and tissue-specific phenotypes. Future studies should consider tissue-specific conditional knockout approaches using Cre-loxP technology to avoid developmental adaptations .

  • Validation approaches: Successful knockdown should be confirmed at multiple levels:

    • mRNA level: Real-time PCR using TaqMan assays or SYBR Green with specific primers

    • Protein level: Western blot with validated antibodies

    • Functional level: Enzymatic activity assays showing reduced AGPAT activity

    • Metabolic level: Altered lipid profiles consistent with reduced enzyme activity

The development of AGPAT10/GPAT3 knockdown or overexpression mouse models represents an important future direction to ascertain the precise physiological roles of these enzymes and their relationship to Agpat1 function .

How might integrating Agpat1 research with advanced imaging technologies enhance our understanding?

Integration of Agpat1 research with advanced imaging technologies offers promising new research directions:

  • Automated IHC quantification: Digital pathology software enables objective assessment of AGPAT1 expression in tissue samples. This approach has successfully mirrored proteomic findings, with higher composite scores in PSC-UC compared to UC. Further development of this methodology could yield clinical diagnostic applications .

  • Multiparametric tissue analysis: Combining AGPAT1 IHC with multiplexed immunofluorescence for inflammatory markers could provide spatial context for understanding how lipid metabolism intersects with immune function in disease states. This approach would allow correlation of AGPAT1 expression with specific cell populations and activation states .

  • In vivo metabolic imaging: Development of tracers targeting lipid metabolic pathways could enable non-invasive assessment of AGPAT1 activity. Integration with techniques like magnetic resonance spectroscopy might allow longitudinal monitoring of lipid metabolism in models of metabolic disease .

The development of artificial intelligence-based scoring systems for tissue biomarkers represents a particularly promising avenue for translating basic AGPAT1 research into clinical applications. Such approaches could enable more precise patient stratification and personalized treatment approaches for inflammatory and metabolic conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.