Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To request a specific tag, please indicate this in your order; we will prioritize your request.
Synonyms
Agpat2; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-AGP acyltransferase 2; 1-AGPAT 2; Lysophosphatidic acid acyltransferase beta; LPAAT-beta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDPWPWLTAALLLLLLLVQLSRTARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNM SIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAK RELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGD LLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDAD VTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ
Uniprot No.

Target Background

Function

This recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2) catalyzes the conversion of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.

Gene References Into Functions
  1. Adipogenically induced Agpat2(-/-) preadipocytes exhibited fewer lipid-loaded cells and reduced levels of adipocyte markers compared to wild-type preadipocytes. PMID: 26417690
  2. Leptin improved insulin resistance and hepatic steatosis in Agpat2-/- lipodystrophic mice, independent of hepatocyte leptin receptors. PMID: 24293639
  3. The absence of normal insulin signaling in Agpat2(-/-) livers permits unregulated phosphatidic acid-induced gluconeogenesis. PMID: 24425876
  4. Agpat2 regulates adipogenesis by modulating lipid metabolism/signal transduction, affecting the normal activation of phosphatidylinositol 3-kinase (PI3K)/Akt and PPARγ signaling during early adipogenesis. PMID: 22872237
  5. Studies suggest a minimal role for AGPAT1 or AGPAT2 in liver lipogenesis, with liver fat accumulation primarily resulting from insulin resistance. PMID: 21873652
  6. Agpat2 null mice exhibit adipocyte loss through necrosis and apoptosis. PMID: 21051554
  7. Mutations in AGPAT2 are prevalent among human lipodystrophies. PMID: 12765973
  8. Impaired AGPAT2 activity impacts phosphatidic acid (PA) availability for triacylglycerol synthesis, but not overall PA synthesis or PA utilization for phospholipid synthesis. PMID: 16495223
  9. The alternative monoacylglycerol pathway for triglyceride biosynthesis is activated in the absence of 1-acylglycerol-3-phosphate O-acyltransferase 2. PMID: 19187773
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high levels in the liver, at intermediate levels in the kidney, gut, heart and skeletal muscles. Undetectable in brain and spleen.

Q&A

What is the primary function of Agpat2 in lipid metabolism?

Agpat2 (1-acyl-sn-glycerol-3-phosphate acyltransferase beta) is a critical enzyme in the biosynthesis pathway of phospholipids and triacylglycerol (TAG). The enzyme specifically catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA) by adding a fatty acyl group to the sn-2 position of LPA. This reaction represents a key step in the glycerophospholipid and TAG biosynthesis pathways, making Agpat2 essential for normal adipose tissue development and function. PA serves as a crucial lipid intermediate that can be further metabolized to form various phospholipids and TAG, the primary storage form of energy in adipocytes .

The enzymatic activity of Agpat2 is particularly important in adipose tissue, where it has high expression levels. Research has demonstrated that Agpat2 deficiency leads to severely impaired lipid synthesis in adipocytes, preventing normal adipose tissue development and resulting in congenital generalized lipodystrophy (CGL) Type 1 .

How is Agpat2 structurally characterized and what domains are critical for its function?

Agpat2 is an integral membrane protein of the endoplasmic reticulum consisting of 278 amino acids in humans. The enzyme contains several highly conserved motifs that are essential for its catalytic activity. Two particularly important motifs are the NHX₄D and EGTR sequences, which are conserved across AGPAT family members . These motifs form the catalytic core of the enzyme and are critical for substrate binding and acyltransferase activity.

Structural analysis indicates that mutations near these conserved regions can dramatically impact enzymatic function. For instance, the V167A mutation, which is located close to the EGTR motif, completely abolishes enzymatic activity. In contrast, the V67M mutation, which is positioned further from the catalytic center, only reduces activity by approximately 50% . These findings highlight the importance of specific amino acid residues in maintaining the proper conformation of the enzyme's active site.

What is the tissue expression pattern of Agpat2 in mice and how does it compare to humans?

Agpat2 shows a distinct tissue-specific expression pattern in mice, with the highest expression levels observed in adipose tissue. Both white adipose tissue (WAT) and brown adipose tissue (BAT) express significant amounts of Agpat2, reflecting its crucial role in adipocyte development and function. The liver also expresses Agpat2, though at lower levels compared to adipose tissue .

This expression pattern is largely conserved between mice and humans, with both species showing predominant expression in adipose tissue. In humans, studies of individuals with AGPAT2 mutations causing CGL1 show a near-complete absence of both white and brown adipose tissue, mirroring the phenotype observed in Agpat2-deficient mice . This conservation of expression patterns and physiological roles makes mouse models particularly valuable for studying the function of Agpat2 in adipose tissue development and lipid metabolism disorders.

How does Agpat2 interact with CDP-diacylglycerol synthases and what are the implications for lipid metabolism?

Agpat2 forms a direct and stable interaction with CDP-diacylglycerol synthases (CDS1 and CDS2), which are enzymes that catalyze the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG). This interaction has significant implications for lipid metabolism coordination in the endoplasmic reticulum .

Co-immunoprecipitation experiments have demonstrated that human AGPAT2 interacts with both CDS1 and CDS2 with similar affinity. Furthermore, two-step affinity purification using Strep-tagged AGPAT2 and Flag-tagged CDS1/2 confirmed a direct and stable interaction between these proteins. Notably, this interaction appears to be specific to AGPAT2, as other AGPAT isoforms (AGPAT1, 3, 4, and 5) showed minimal co-precipitation with CDS1/2 .

The functional significance of this interaction is highlighted by the finding that AGPAT2 deficiency compromises the stability of CDS proteins and decreases CDS activity. When AGPAT2 is knocked down, both CDS1 and CDS2 protein levels are reduced, although their mRNA levels remain unchanged, suggesting post-transcriptional regulation. This destabilization of CDS proteins contributes to altered lipid metabolism in AGPAT2-deficient cells, resulting in the formation of abnormally large lipid droplets and increased triacylglycerol accumulation .

What metabolic changes occur in Agpat2-deficient mice, and how do these relate to human lipodystrophy?

Agpat2-deficient mice develop a phenotype that closely resembles congenital generalized lipodystrophy type 1 (CGL1) in humans. These mice exhibit a near-total loss of both white and brown adipose tissue, accompanied by severe metabolic derangements including:

  • Hepatic steatosis (fatty liver)

  • Insulin resistance

  • Hyperglycemia

  • Hypertriglyceridemia

  • Altered energy metabolism

Metabolic analysis of Agpat2-deficient mice shows significant changes in gene expression related to hepatic lipid metabolism. In particular, genes involved in de novo lipogenesis are upregulated, contributing to increased hepatic fat accumulation .

The table below summarizes key metabolic parameters in wild-type, Agpat2-deficient, and Agpat2-reconstituted mice:

ParameterWild-type miceAgpat2-deficient miceAgpat2-reconstituted mice (Tg-AT-hA2;mA2^(-/-))
Adipose tissueNormalNear-absentPartial regeneration (30-50%)
Hepatic steatosisMinimalSeverePartially ameliorated
Fasting plasma glucoseNormalElevatedNormal
Serum insulin levelsNormalHighly elevatedMarkedly reduced
Energy balanceNormalDysregulatedNormalized

Importantly, even partial regeneration of adipose tissue in Agpat2-deficient mice through regulated expression of human AGPAT2 can significantly ameliorate metabolic derangements. This suggests that therapeutic approaches targeting AGPAT2 function or adipose tissue regeneration might be beneficial for treating human lipodystrophy .

How does overexpression of Agpat2 in adipose tissue affect TAG synthesis and metabolic outcomes?

Adipose-specific overexpression of Agpat2 provides important insights into its role in triacylglycerol (TAG) synthesis and metabolic regulation. In mouse models where human AGPAT2 is specifically overexpressed in adipose tissue (AT), researchers have observed several significant outcomes :

Overexpression of AGPAT2 in adipose tissue does not necessarily lead to increased TAG synthesis and obesity as might be expected. Instead, the relationship between AGPAT2 expression and TAG synthesis appears to be more complex. When human AGPAT2 is overexpressed in the background of normal mouse Agpat2 expression, there is not a proportional increase in TAG synthesis. This suggests that AGPAT2 activity may not be the rate-limiting step in TAG synthesis under normal conditions, or that there are compensatory mechanisms that regulate total TAG production .

The experimental approach using doxycycline-regulated expression of human AGPAT2 in mouse adipose tissue has been particularly valuable for understanding the dynamic role of this enzyme. By turning AGPAT2 expression on and off through doxycycline administration, researchers have demonstrated that AGPAT2 is essential not only for adipose tissue development but also for its maintenance. When AGPAT2 expression is turned off by removing doxycycline from the diet, adipose tissue becomes undetectable within approximately eight weeks, highlighting the ongoing requirement for AGPAT2 activity in adipocyte function .

What are the most effective methods for measuring Agpat2 enzymatic activity in vitro?

The gold standard for measuring Agpat2 enzymatic activity involves monitoring the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA) using mass spectrometry. This approach provides accurate quantification of reaction products and allows direct assessment of enzyme kinetics. The methodology involves several critical steps:

  • Enzyme preparation: Immunopurification of recombinant Agpat2 protein, typically FLAG-tagged for purification purposes.

  • Substrate preparation: Preparation of purified LPA and oleoyl-CoA as substrates.

  • Reaction conditions: Incubation of purified enzyme with substrates under controlled temperature and pH conditions.

  • Product detection: Quantification of PA production using mass spectrometry.

This approach has been successfully used to evaluate the impact of Agpat2 mutations on enzymatic activity. For instance, research has shown that the V167A mutation completely abolishes enzymatic activity, while the V67M mutation retains approximately 50% activity compared to wild-type Agpat2 .

The following table summarizes relative enzymatic activities of wild-type and mutant Agpat2 as determined by mass spectrometry:

Agpat2 variantRelative PA synthesis (% of wild-type)Statistical significance
Wild-type100%Reference
V67M50%p < 0.05
V167ANot detectablep < 0.001
V67M/V167ANot detectablep < 0.001

Alternative methods for assessing Agpat2 activity include radiometric assays using radiolabeled substrates, which can provide high sensitivity but require special handling procedures for radioactive materials .

What strategies are most effective for generating transgenic mouse models with regulated Agpat2 expression?

Creating transgenic mouse models with regulated Agpat2 expression requires sophisticated genetic engineering approaches. Based on successful strategies described in the literature, the following methodological framework is recommended:

  • Multi-component genetic system design: An effective approach involves generating and crossing multiple mouse lines to achieve tissue-specific, regulated expression of Agpat2. The key components include:

    • A transgenic line expressing human AGPAT2 under control of a tetracycline-responsive element (TRE) promoter system

    • A line expressing reverse tetracycline transactivator (rtTA) driven by a tissue-specific promoter (e.g., adiponectin promoter for adipose tissue-specific expression)

    • An Agpat2 knockout or conditional knockout line

  • Doxycycline-inducible expression system: The TRE-tight/PminCMV promoter system coupled with rtTA provides temporal control of gene expression through doxycycline administration. This system allows researchers to turn Agpat2 expression on and off at specific timepoints by adding or removing doxycycline from the diet .

  • Verification of transgene expression: Confirmation of proper transgene expression and regulation should include:

    • RT-PCR and Western blot analysis to verify tissue-specific expression

    • Assessment of expression levels in response to doxycycline administration

    • Functional validation through enzymatic activity assays

  • Breeding strategy: The generation of experimental mice typically requires multiple rounds of crossing to combine all necessary genetic elements. For example, the creation of Tg-AT-hA2;mA2^(-/-) mice involves crossing three different mouse lines and selecting for specific genotypes .

This approach has been successfully implemented to create mouse models with adipose tissue-specific, doxycycline-regulated expression of human AGPAT2 in the background of mouse Agpat2 deficiency, enabling detailed studies of Agpat2 function in adipose tissue development and lipid metabolism .

How can researchers effectively investigate the interaction between Agpat2 and CDS proteins?

Investigating the interaction between Agpat2 and CDP-diacylglycerol synthase (CDS) proteins requires multiple complementary approaches to establish both physical interaction and functional significance. The following methodological strategies have proven effective:

  • Co-immunoprecipitation (Co-IP) studies: This technique provides direct evidence of protein-protein interactions. For optimal results:

    • Express tagged versions of Agpat2 and CDS proteins (e.g., FLAG, Strep, or GFP tags)

    • Perform reciprocal co-IPs (pulling down each protein and detecting the other)

    • Include appropriate controls (non-interacting proteins, tag-only controls)

    • Use mild detergent conditions to preserve membrane protein interactions

  • Two-step affinity purification: This more stringent approach confirms direct and stable interactions:

    • Express differentially tagged proteins (e.g., Strep-tagged Agpat2 and FLAG-tagged CDS1/2)

    • Perform sequential purification using both tags

    • Analyze co-purified proteins by Coomassie staining and mass spectrometry

  • CRISPR-mediated endogenous tagging: This strategy allows visualization and analysis of endogenous protein interactions:

    • Tag endogenous Agpat2 with sfGFP and CDS2 with mScarlet at their genomic loci

    • Verify expression by fluorescence microscopy and Western blotting

    • Perform co-IP experiments with endogenously tagged proteins

  • Colocalization studies: Microscopy-based approaches provide spatial information about protein interactions:

    • Use confocal microscopy to assess colocalization of fluorescently tagged proteins

    • Test different cellular conditions (e.g., varying glucose levels) to identify factors that enhance interaction

    • Quantify colocalization using appropriate image analysis software

  • Functional validation: Demonstrate the biological significance of the interaction:

    • Assess CDS protein levels and activity in Agpat2-deficient cells or tissues

    • Perform rescue experiments with wild-type or mutant Agpat2

    • Measure lipid profiles to determine metabolic consequences of disrupted interaction

Using these methodologies, researchers have established that Agpat2 specifically interacts with CDS1 and CDS2, promoting their stability and activity. This interaction appears to be unique to Agpat2 among the AGPAT family members and is influenced by cellular metabolic conditions .

How should researchers analyze and interpret conflicting data on Agpat2 function in different experimental models?

When confronted with conflicting data on Agpat2 function across different experimental models, researchers should implement a systematic analytical approach that considers multiple factors:

  • Model-specific variables: Different experimental systems may produce varying results due to:

    • Species differences (human vs. mouse Agpat2)

    • Cell type-specific effects (HeLa vs. Huh7 vs. primary adipocytes)

    • Knockout vs. knockdown methodologies (complete absence vs. reduced expression)

    • Acute vs. chronic Agpat2 deficiency (developmental vs. acquired effects)

  • Expression level considerations: The level of Agpat2 expression significantly impacts phenotypic outcomes:

    • Complete knockout of Agpat2 in mice produces severe lipodystrophy

    • Partial expression (30-50% of normal) can support significant adipose tissue development

    • Overexpression does not necessarily increase TAG synthesis proportionally

  • Compensatory mechanisms: Conflicting results may reflect differential activation of compensatory pathways:

    • Other AGPAT family members may partially compensate for Agpat2 deficiency

    • Alternative lipid synthesis pathways may be upregulated

    • Tissue-specific compensatory mechanisms may exist

  • Sex-specific differences: Research has identified sex-specific responses in Agpat2-deficient models:

    • Sex-specific regulation of certain lipogenic genes (e.g., Mogat1) occurs in Agpat2-deficient mice

    • Female mice show different expression patterns of certain genes compared to males under Agpat2 deficiency

  • Integration of multiple data types: To resolve conflicts, researchers should integrate:

    • Genetic data (mutations, expression levels)

    • Biochemical data (enzymatic activity, protein-protein interactions)

    • Phenotypic data (lipid profiles, adipose tissue development)

    • Transcriptomic data (gene expression changes)

A particularly valuable approach is to use inducible expression systems that allow direct comparison of the same genetic background with and without Agpat2 expression. The doxycycline-regulated system described in several studies provides an excellent platform for such comparative analyses, enabling researchers to distinguish primary effects of Agpat2 deficiency from secondary adaptations .

What criteria should be used to evaluate the pathogenicity of novel Agpat2 variants identified in research or clinical settings?

Evaluating the pathogenicity of novel Agpat2 variants requires a comprehensive assessment approach combining computational prediction, functional characterization, and clinical correlation. Researchers should consider the following criteria:

  • Computational prediction tools: Multiple algorithms should be employed to predict functional impact:

    • PROVEAN (Protein Variation Effect Analyzer) for predicting the impact of amino acid substitutions

    • DUET for predicting effects on protein stability

    • SIFT, Mutation Assessor, CAD, and Revel for combined predictions

  • Population frequency data: Assess variant frequency in general population databases:

    • ExAC database

    • 1,000 Genome Project

    • dbSNP

    • Exome Variant Server

    • ClinVar database

  • Structural and evolutionary considerations:

    • Location relative to conserved motifs (e.g., NHX₄D, EGTR)

    • Evolutionary conservation across species

    • Proximity to known functional domains

  • Enzymatic activity assessment: Direct measurement of variant impact on enzymatic function:

    • In vitro enzymatic assays measuring conversion of LPA to PA

    • Comparison with known pathogenic and benign variants

    • Quantitative assessment of activity reduction (partial vs. complete loss)

  • Protein stability and interaction studies:

    • Effect on protein expression levels

    • Impact on interactions with partner proteins (e.g., CDS1/2)

    • Cellular localization of variant protein

A variant would typically be classified as pathogenic if it:

  • Is rare in population databases (allele frequency <0.5%)

  • Shows significant reduction in enzymatic activity (<10% of wild-type)

  • Affects highly conserved residues or functional domains

  • Is predicted to be deleterious by multiple computational tools

  • Demonstrates impaired protein stability or interactions

For example, the V167A variant has been conclusively demonstrated to be pathogenic based on its complete abolishment of enzymatic activity in vitro, while the V67M variant shows an intermediate impact with approximately 50% reduction in activity .

How can gene expression data be effectively analyzed to understand the metabolic consequences of Agpat2 deficiency?

Analyzing gene expression data to understand the metabolic consequences of Agpat2 deficiency requires a structured approach that integrates transcriptomic data with functional pathway analysis:

  • Tissue-specific gene expression profiling:

    • Compare expression profiles in liver, adipose tissue, and muscle from Agpat2-deficient and wild-type mice

    • Analyze changes during different metabolic states (fasting, fed, exercise)

    • Consider sex-specific differences in gene expression patterns

  • Pathway-focused analysis: Group genes into functional categories related to:

    • De novo lipogenesis (DNL)

    • Fatty acid oxidation

    • Gluconeogenesis

    • Insulin signaling

    • Inflammation pathways

  • Key gene expression changes: Several specific genes show consistent alterations in Agpat2 deficiency:

    • Reduced expression of adipogenic factors (PPARγ, C/EBPα)

    • Increased expression of hepatic lipogenic genes (Srebp-1c, Fasn)

    • Altered expression of fatty acid oxidation genes (PPARα, Ucp2)

The table below summarizes key hepatic gene expression changes in Agpat2-deficient mice compared to wild-type controls:

GeneFunctionExpression in Agpat2-deficient miceResponse to Agpat2 reconstitution
Srebp-1cLipogenic transcription factorIncreasedPartially normalized
FasnFatty acid synthesisIncreasedDecreased
Scd1Fatty acid desaturationIncreasedDecreased
Ucp2Mitochondrial uncouplingIncreasedDecreased
Mogat1*Monoacylglycerol acylationIncreasedSex-specific normalization

*Mogat1 shows sex-specific regulation, with normalization observed in females but not males upon Agpat2 reconstitution .

  • Temporal analysis: Examine gene expression changes over time:

    • Early vs. late responses to Agpat2 deficiency

    • Acute vs. chronic adaptations

    • Changes during adipose tissue regeneration in inducible models

  • Integration with physiological data: Correlate gene expression changes with:

    • Lipid profiles (hepatic triglycerides, serum lipids)

    • Glucose homeostasis parameters (glucose tolerance, insulin sensitivity)

    • Energy expenditure and substrate utilization

This integrated approach helps distinguish primary consequences of Agpat2 deficiency from secondary adaptations and compensatory mechanisms, providing a more comprehensive understanding of how Agpat2 regulates metabolic homeostasis .

How can researchers optimize the design of doxycycline-regulated Agpat2 expression systems for adipose tissue regeneration studies?

Optimizing doxycycline-regulated Agpat2 expression systems for adipose tissue regeneration studies requires careful consideration of several key design elements:

  • Promoter selection: The adiponectin promoter has proven highly effective for adipose tissue-specific expression. This promoter offers:

    • Strong expression specifically in mature adipocytes

    • Minimal leakage in non-adipose tissues

    • Compatibility with the rtTA system for doxycycline-mediated regulation

  • Tetracycline-responsive element optimization: The TRE-tight/PminCMV promoter system provides superior control of transgene expression:

    • Minimal basal expression in the absence of doxycycline

    • Strong induction upon doxycycline administration

    • Dose-dependent expression level control

  • Doxycycline administration protocol:

    • Dietary administration (typically 600 mg/kg in chow) provides consistent exposure

    • Treatment should begin either during embryonic development (through maternal feeding) or at specific postnatal timepoints depending on research objectives

    • Serum doxycycline levels should be monitored to ensure consistent exposure

    • Washout periods of 7-8 weeks are typically required for complete transgene silencing

  • Combined genetic strategy: The optimal system incorporates three genetic elements:

    • TRE-driven human AGPAT2 transgene

    • Adiponectin promoter-driven rtTA expression cassette

    • Endogenous mouse Agpat2 knockout alleles

This system allows for precise temporal control of Agpat2 expression exclusively in adipose tissue, enabling researchers to address questions about both adipose tissue development and maintenance. The model has successfully demonstrated that:

  • Embryonic expression of human AGPAT2 enables partial adipose tissue development (30-50% of normal) in otherwise lipodystrophic mice

  • Continued expression is required for adipose tissue maintenance

  • Withdrawal of doxycycline leads to adipose tissue loss within 8 weeks

  • Restoration of Agpat2 expression partially reverses metabolic abnormalities associated with lipodystrophy

What parameters should be monitored when evaluating the metabolic phenotype of Agpat2-deficient or Agpat2-overexpressing mice?

Comprehensive evaluation of the metabolic phenotype in Agpat2-deficient or Agpat2-overexpressing mice requires assessment of multiple physiological parameters across different tissues and metabolic states:

  • Adipose tissue parameters:

    • Total fat mass (by DEXA scan, MRI, or dissection and weighing)

    • Distribution of different adipose depots (subcutaneous, visceral, brown)

    • Adipocyte size and number (histological analysis)

    • Gene expression profile of adipogenic and lipogenic markers

    • Lipolytic response to fasting and β-adrenergic stimulation

  • Glucose homeostasis:

    • Fasting blood glucose levels

    • Fasting and postprandial insulin levels

    • Glucose tolerance test (GTT)

    • Insulin tolerance test (ITT)

    • Hyperinsulinemic-euglycemic clamp (gold standard for insulin sensitivity)

    • Tissue-specific glucose uptake using radiolabeled glucose

  • Lipid metabolism:

    • Serum triglycerides, free fatty acids, and cholesterol levels

    • Hepatic triglyceride content (biochemical and histological assessment)

    • Expression of lipogenic genes in liver and adipose tissue

    • De novo lipogenesis rates using isotope tracers

    • Lipoprotein profile (VLDL, LDL, HDL)

  • Energy balance:

    • Food intake

    • Energy expenditure (indirect calorimetry)

    • Respiratory exchange ratio (RER) to assess substrate utilization

    • Physical activity levels

    • Body temperature and cold tolerance

  • Inflammatory markers:

    • Serum cytokine levels (TNF-α, IL-6, etc.)

    • Tissue macrophage infiltration (immunohistochemistry)

    • Expression of inflammatory genes in adipose tissue and liver

Comparative analysis of these parameters between different experimental groups (e.g., wild-type, Agpat2-deficient, and Agpat2-reconstituted mice) provides comprehensive insights into the metabolic consequences of altered Agpat2 expression. Research has shown that even partial restoration of adipose tissue in Agpat2-deficient mice can significantly improve metabolic parameters, including normalized blood glucose levels, reduced insulin levels, and reduced hepatic steatosis .

What are the key considerations for studying the interaction between Agpat2 and CDP-diacylglycerol synthases in vivo?

Studying the interaction between Agpat2 and CDP-diacylglycerol synthases (CDS) in vivo presents unique challenges and requires specialized approaches to establish both physical interactions and functional relationships in a physiological context:

  • Tissue-specific expression analysis:

    • Quantify expression levels of Agpat2, CDS1, and CDS2 across different tissues

    • Determine cellular and subcellular localization using immunohistochemistry

    • Assess developmental regulation of expression patterns

    • Compare expression levels in wild-type and metabolically challenged states

  • In vivo protein-protein interaction approaches:

    • Proximity ligation assays in tissue sections to detect endogenous protein interactions

    • Tissue-specific expression of tagged proteins for co-immunoprecipitation from tissue lysates

    • CRISPR-mediated endogenous tagging of proteins in mice for visualization and pull-down studies

    • Cross-linking approaches to stabilize transient interactions before tissue processing

  • Functional relationship assessment:

    • Generate liver-specific Agpat2 knockout mice (A2LKO) to assess CDS protein levels and activity in vivo

    • Measure CDS enzymatic activity in tissues from wild-type and Agpat2-deficient mice

    • Perform lipidomic analysis to determine the impact on CDP-DAG and derived lipids

    • Assess the phenotypic consequences of combined Agpat2 and CDS deficiency

  • Rescue experiments:

    • Test whether overexpression of CDS1/2 can rescue aspects of the Agpat2-deficient phenotype

    • Determine if stabilization of CDS proteins through alternative mechanisms can bypass the requirement for Agpat2

    • Evaluate whether tissue-specific restoration of Agpat2 normalizes CDS protein levels and activity

  • Metabolic challenge models:

    • Examine how fasting, high-fat diet, or exercise affects the Agpat2-CDS interaction

    • Determine if the interaction is altered in metabolic disease states

    • Assess whether pharmacological interventions targeting lipid metabolism modify the interaction

Research has demonstrated that liver-specific knockout of Agpat2 in mice (A2LKO) results in reduced CDS2 protein levels and decreased CDS enzymatic activity, confirming that the functional connection between these proteins observed in cell culture extends to the in vivo setting. This finding provides important validation of the physiological relevance of the Agpat2-CDS interaction in regulating lipid metabolism .

How can recombinant Agpat2 be utilized in the development of therapeutic approaches for lipodystrophy?

Recombinant Agpat2 offers several promising avenues for therapeutic development targeting lipodystrophy, based on mechanistic understanding of its role in adipose tissue development and maintenance:

  • Enzyme replacement therapy (ERT):

    • Recombinant Agpat2 could potentially be delivered to patients with specific mutations

    • Key challenges include appropriate targeting to adipocyte precursors and ensuring intracellular delivery

    • Modifications such as cell-penetrating peptides or nanoparticle formulations may improve cellular uptake

  • Gene therapy approaches:

    • Adeno-associated virus (AAV) vectors expressing functional Agpat2 could target adipose tissue precursors

    • Inducible expression systems similar to those used in mouse models could provide regulated expression

    • The finding that even 30-50% restoration of adipose tissue mass significantly improves metabolic parameters suggests partial correction may be therapeutically beneficial

  • Small molecule modulators:

    • Compounds that stabilize mutant Agpat2 protein could rescue function in cases where mutations affect stability rather than catalytic activity

    • Molecules that enhance the stability and activity of CDS1/2 might bypass the requirement for Agpat2 function

    • Activators of alternative pathways for phosphatidic acid generation could potentially compensate for Agpat2 deficiency

  • Cellular therapy:

    • Adipocyte progenitors engineered to express functional Agpat2 could be transplanted into patients

    • Induced pluripotent stem cells (iPSCs) from patients could be corrected by CRISPR and differentiated into adipocytes for autologous transplantation

    • The doxycycline-regulated system established in mouse models provides proof-of-concept for regulated expression in cellular therapeutics

Research in transgenic mouse models has demonstrated that even partial restoration of adipose tissue through regulated expression of human AGPAT2 can significantly ameliorate the metabolic abnormalities associated with lipodystrophy, including hepatic steatosis, insulin resistance, and dysregulated energy balance. This suggests that therapeutic strategies achieving even incomplete correction of AGPAT2 deficiency may provide substantial clinical benefit .

What experimental approaches can address the ongoing debate about whether Agpat2 deficiency prevents TAG biosynthesis in existing adipocytes or prevents adipocyte development?

The debate about whether Agpat2 deficiency primarily affects triacylglycerol (TAG) biosynthesis in existing adipocytes or fundamentally prevents adipocyte development can be addressed through several sophisticated experimental approaches:

  • Temporal control of Agpat2 expression:

    • Use inducible knockout systems to delete Agpat2 in fully differentiated adipocytes

    • Analyze the fate of mature adipocytes following Agpat2 deletion (apoptosis vs. dedifferentiation vs. persistence without TAG)

    • The finding that withdrawing doxycycline from Tg-AT-hA2;mA2^(-/-) mice leads to adipose tissue loss within 8 weeks suggests ongoing Agpat2 requirement

  • Single-cell analysis of adipose tissue:

    • Perform single-cell RNA sequencing on adipose tissue from Agpat2-deficient mice to identify cell populations

    • Compare adipocyte precursor populations between wild-type and Agpat2-deficient tissues

    • Trace the developmental trajectory of adipocyte lineage cells in the presence and absence of Agpat2

  • In vitro adipocyte differentiation studies:

    • Isolate preadipocytes from wild-type and Agpat2-deficient mice

    • Assess differentiation capacity and lipid accumulation under various conditions

    • Test whether providing phosphatidic acid or downstream metabolites rescues differentiation

  • Lineage tracing experiments:

    • Generate mice with fluorescent reporters under control of early adipocyte commitment markers

    • Track the fate of these cells in Agpat2-deficient backgrounds

    • Determine whether committed preadipocytes exist but fail to accumulate lipid, or whether commitment itself is impaired

  • Metabolic flux analysis:

    • Use isotope tracers to measure TAG synthesis rates in adipose tissue with varying levels of Agpat2 expression

    • Determine whether partial Agpat2 expression (as in doxycycline-regulated systems) results in proportional TAG synthesis

    • Identify potential compensatory pathways for TAG synthesis in Agpat2-deficient cells

How might multi-omics approaches enhance our understanding of Agpat2 function in lipid metabolism regulation?

Integrated multi-omics approaches offer powerful strategies to comprehensively understand Agpat2 function in regulating lipid metabolism across multiple biological scales:

  • Genomics + Transcriptomics:

    • Whole genome sequencing to identify natural variants affecting Agpat2 expression or function

    • RNA-seq analysis of multiple tissues in Agpat2-deficient and wild-type mice to identify transcriptional networks

    • Single-cell transcriptomics to understand cell-type specific responses to Agpat2 deficiency

    • Integration of genomic and transcriptomic data to identify potential regulatory elements

  • Proteomics + Interactomics:

    • Proximity labeling approaches (BioID, APEX) to identify the complete Agpat2 interactome

    • Quantitative proteomics to determine protein abundance changes in Agpat2-deficient tissues

    • Phosphoproteomics to identify signaling pathways affected by Agpat2 deficiency

    • Cross-linking mass spectrometry to map detailed protein-protein interaction interfaces

  • Lipidomics + Metabolomics:

    • Comprehensive lipidomic profiling to quantify changes in lipid species across tissues

    • Flux analysis using stable isotope tracers to measure lipid synthesis and turnover rates

    • Spatial lipidomics to determine subcellular distribution of lipid species

    • Integration with metabolomics to identify connected metabolic pathways

  • Structural Biology:

    • Cryo-EM or X-ray crystallography of Agpat2 alone and in complex with CDS1/2

    • Molecular dynamics simulations to understand conformational changes upon substrate binding

    • Structure-based drug design for potential therapeutic modulators

  • Systems Biology Integration:

    • Mathematical modeling of lipid metabolism incorporating Agpat2 activity

    • Network analysis to identify key control points in lipid metabolic pathways

    • Predictive modeling of metabolic responses to varying Agpat2 expression levels

A particularly promising approach is the integration of lipidomics with protein-protein interaction data to understand how Agpat2 coordinates with other enzymes like CDS1/2 to regulate the flux of lipid intermediates. Recent research has already demonstrated that Agpat2 interacts with CDS proteins to form a functional complex that coordinates the conversion of LPA to PA and subsequently to CDP-DAG .

Multi-omics approaches could further elucidate how these protein complexes respond to different metabolic states, such as fasting, feeding, or exercise, and how they are dysregulated in pathological conditions like obesity, insulin resistance, or lipodystrophy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.