Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (Agpat4)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (Agpat4) is a key enzyme in lipid biosynthesis, catalyzing the conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA) by transferring an acyl group to the sn-2 position of the glycerol backbone . This enzyme plays critical roles in glycerolipid metabolism, membrane biogenesis, and cellular signaling. Its recombinant form enables detailed biochemical and therapeutic studies.

Recombinant Production Systems

Recombinant Agpat4 is produced in heterologous expression systems to study its biochemical properties and physiological roles:

Expression Platforms

  • E. coli: Used for high-yield production of His-tagged Agpat4 (1-378 aa) with >90% purity .

  • HEK-293 Cells: Employed for eukaryotic post-translational modifications .

  • Cell-Free Systems: ALiCE® platform (Nicotiana tabacum lysate) enables rapid, tag-free synthesis .

Purification and Validation

  • Tags: His or Strep tags facilitate affinity chromatography .

  • Purity: Validated via SDS-PAGE and HPLC, achieving >70-90% purity .

Tissue-Specific Expression

  • Adipose Tissue: Agpat4 ablation in mice causes epididymal white adipose tissue (WAT) hypertrophy (+40% mass) due to reduced lipolysis, but no changes in perirenal WAT .

  • Brain: Regulates phosphatidylinositol (PI), phosphatidylcholine (PC), and phosphatidylethanolamine (PE) levels, impacting cognitive function .

  • Muscle: Modulates skeletal muscle fiber composition and contractility via PA signaling .

Regulatory Mechanisms

  • PPARα Dependence: Cardiac Agpat4 activity is reduced by 25% in PPARα-null mice, with mRNA levels of Agpat3 upregulated as compensation .

  • Lipid Signaling: Agpat4-derived PA influences membrane curvature during fission events via interactions with BARS/14-3-3γ/PI4KIIIβ complexes .

5.1.1 Cancer

  • Colorectal Cancer (CRC): Agpat4 silencing reduces LPA levels in CRC cells, polarizing macrophages to an M1 phenotype and enhancing CD8+/CD4+ T-cell antitumor responses .

    • Key Mechanism: Agpat4/LPA axis regulates p38/p65 signaling in macrophages, suppressing tumor growth in xenograft models .

5.1.2 Metabolic Disorders

  • Lipodystrophy: Contrasts with Agpat2 knockout models (complete loss of adipose tissue), highlighting AGPAT4's depot-specific redundancy .

Therapeutic Targets

  • Enzyme Inhibitors: AGPAT4 inhibitors could modulate lipid signaling in cancer or metabolic diseases .

  • Gene Therapy: Overexpression studies in Drosophila and murine models elucidate lipid-related pathologies .

Comparative Analysis of Recombinant Agpat4 Variants

ParameterE. coli-Expressed HEK-293-Expressed
Host SystemProkaryoticEukaryotic
Post-Translational ModificationsLimitedPhosphorylation, glycosylation
Purity>90% (SDS-PAGE)>90% (Bis-Tris Page)
ApplicationsStructural studies, enzymatic assaysCell-based assays, signaling studies

Emerging Research Directions

  • Truncated Isoforms: A novel splice variant (X2/X3) lacking Motif I is expressed in murine tissues, potentially acting as a dominant-negative regulator .

  • Lipidomics: AGPAT4’s role in PA species diversity and membrane remodeling remains underexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, keep working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
Agpat4; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQ LVMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKV LAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRF TEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRNNENPTL LGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPETPWV PPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTE IDKGSAYGNIDNKRKQTD
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. It exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, particularly docosahexaenoyl-CoA (22:6-CoA, DHA-CoA).
Gene References Into Functions
  1. Studies using Lpaat-delta deficient mice demonstrate a significant role for murine Lpaat-delta in muscle contractile force generation in the soleus and extensor digitorum longus muscles. PMID: 29627383
  2. Agpat4/Lpaatdelta deficiency highlights the molecular heterogeneity of epididymal and perirenal white adipose depots. PMID: 28814640
  3. Research findings indicate that Lpaatdelta deficiency leads to learning and memory impairments associated with reduced NMDA and AMPA receptors. PMID: 28807933
  4. Findings suggest that AGPAT4 is a mitochondrial AGPAT/LPAAT that specifically supports the synthesis of brain PI, PC, and PE. PMID: 26417903
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at a high levels in the brain, at intermediate or low levels in skeletal muscles, gut, kidney, spleen and lung. Barely detectable in heart and liver.

Q&A

What is the primary function of Agpat4 in cellular metabolism?

Agpat4 functions as a true lysophosphatidic acid acyltransferase (LPAAT) that specifically converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Despite its confirmed LPAAT activity in vitro, Agpat4 has been shown to specifically support the synthesis of phosphatidylinositol (PI), phosphatidylcholine (PC), and phosphatidylethanolamine (PE) in vivo, particularly in brain tissue. This suggests that Agpat4-derived PA forms a functionally distinct substrate pool for the synthesis of these specific downstream phospholipid species .

The enzyme belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family and participates in several metabolic pathways including glycerophospholipid biosynthesis, CDP-diacylglycerol biosynthesis, and fatty acid metabolism . Experimental evidence indicates that Agpat4 is a mitochondrial AGPAT/LPAAT with tissue-specific functions in phospholipid synthesis and metabolism .

How is Agpat4 expressed across different mouse tissues?

  • Brain tissue - where it plays crucial roles in phospholipid synthesis affecting cognitive function

  • Skeletal muscle - influencing fiber type composition and contractile properties

  • Adipose tissue - with consistent expression across different depots

  • Ovary - with significant expression noted in multiple publications

Unlike AGPATs 1 and 3 which show ubiquitous expression, Agpat4 displays tissue-specific distribution patterns more similar to AGPATs 2 and 5. This specificity suggests specialized functions in different tissues despite apparent enzymatic redundancy with other AGPAT isoforms .

What splice variants of Agpat4 have been identified in mouse tissues?

Research has identified multiple splice variants of Agpat4 in murine tissues. Specifically, splice variants X1, X2, and X3 have been confirmed to be endogenously synthesized across various mouse tissues . These variants appear to have functional significance, as studies indicate that truncated AGPAT4 protein levels may be modulated by the co-expression of reference AGPAT4 protein in vitro .

When investigating these splice variants, researchers typically employ RT-PCR methods with specific primers designed to distinguish between variants. The expression levels of these variants may differ between tissue types, potentially contributing to the tissue-specific functions of Agpat4. Understanding these splice variants is particularly important when designing knockout models or conducting protein interaction studies, as truncated variants may retain partial functionality or exhibit dominant-negative effects .

How does Agpat4 gene ablation affect phospholipid metabolism in different tissues?

The effects of Agpat4 gene ablation on phospholipid metabolism demonstrate remarkable tissue specificity, highlighting the complex compartmentalization of lipid synthesis pathways. In the brain, Agpat4 knockout leads to significant decreases in phosphatidylinositol (52%), phosphatidylcholine (39%), and phosphatidylethanolamine (32%) contents relative to wild-type mice, despite unaltered total phosphatidic acid (PA) levels . This suggests that Agpat4-derived PA forms a distinct pool specifically channeled toward these phospholipids.

In adipose tissue, the impact of Agpat4 deletion shows dramatic depot-specific heterogeneity. Epididymal white adipose tissue (WAT) in male knockout mice exhibits a 40% increase in mass with doubled triacylglycerol (TAG) content, while perirenal, retroperitoneal, and inguinal WAT depots remain unchanged . Notably, epididymal WAT shows no compensatory upregulation of other Agpat isoforms, while perirenal WAT demonstrates significant compensatory induction of Agpats 1, 2, 3, and 5 as well as Gpats 1, 2, 3, and 4 .

These findings highlight that:

  • PA likely doesn't form a single cellular pool but is channeled by specific AGPAT/LPAAT homologs into distinct substrate pools

  • This channeling occurs in a tissue-specific manner

  • Compensatory mechanisms involving other AGPAT isoforms differ between tissues

  • The functional consequences of Agpat4 deletion are determined by the availability of alternative enzymes in each tissue

What are the mechanisms behind Agpat4's influence on muscle physiology and function?

Agpat4 exerts significant effects on skeletal muscle fiber type composition and contractile properties through mechanisms that are still being elucidated. Research has revealed that Agpat4 knockout mice display alterations in muscle fiber type distribution, specifically showing reductions in type I and type IIA muscle fibers in the glycolytic extensor digitorum longus (EDL) muscle . Additionally, electrical stimulation tests have demonstrated significant decreases in contractile force in the oxidative soleus muscle of mice lacking Agpat4 .

These skeletal muscle alterations are hypothesized to result from:

  • Decreasing pyruvate dehydrogenase activity, affecting energy metabolism in muscle fibers

  • Alterations in skeletal muscle phosphatidic acid content, potentially impacting membrane properties and signaling

  • Changes in phosphatidylethanolamine levels, which could affect membrane fluidity and protein function

Researchers investigating these mechanisms typically employ a combination of techniques including immunohistochemistry for fiber typing, ex vivo muscle force measurement systems, metabolic enzyme activity assays, and lipidomic analyses to comprehensively characterize the molecular and functional changes in muscle resulting from Agpat4 deficiency .

How does Agpat4 deficiency impact adipose tissue metabolism and expansion?

Agpat4 deficiency produces remarkable depot-specific effects on adipose tissue metabolism and expansion. In male Agpat4 knockout mice, epididymal white adipose tissue (WAT) mass increases by approximately 40% compared to wild-type littermates, while perirenal, retroperitoneal, and inguinal WAT depots remain unchanged . This selective expansion occurs through adipocyte hypertrophy rather than hyperplasia, as evidenced by increased cell size without changes in differentiation markers .

The metabolic alterations underlying this phenotype include:

  • Doubled total epididymal triacylglycerol (TAG) content

  • Reduced total TAG hydrolase activity

  • Significant decreases in adipose triglyceride lipase (ATGL) levels

  • Reduced phosphorylation of hormone-sensitive lipase at the PKA-activation sites S563 and S660

Interestingly, these changes occur despite no changes in enzymes involved in de novo lipogenesis or complex lipid synthesis downstream of phosphatidic acid production. The metabolic profile suggests that impaired lipolysis, rather than increased lipogenesis, drives the adipose expansion. This highlights the role of Agpat4 in maintaining normal lipolytic capacity and adipose tissue homeostasis in a depot-specific manner .

What are the optimal methods for studying Agpat4 enzymatic activity in vitro?

When studying Agpat4 enzymatic activity in vitro, researchers should consider several methodological approaches to accurately assess its function as a lysophosphatidic acid acyltransferase. Based on established research protocols, the following methods are recommended:

  • Cell-free enzyme assays: Utilize recombinant Agpat4 protein expressed in a cell-free system to measure conversion of lysophosphatidic acid (LPA) to phosphatidic acid (PA) by incorporating radiolabeled acyl-CoA donors. Optimal assay conditions include:

    • pH 7.4 buffer containing 50-100 mM Tris-HCl

    • 1-5 mM MgCl₂ as a cofactor

    • 10-50 μM LPA as the acyl acceptor

    • 10-50 μM acyl-CoA (preferably [¹⁴C] or [³H] labeled) as the acyl donor

    • Reaction time of 5-15 minutes at 37°C

  • Cellular overexpression systems: For functional studies, Sf9 insect cells or mammalian cell lines (HEK293, COS-7) can be transfected with Agpat4 expression vectors. When using these systems:

    • Include appropriate controls (empty vector, inactive mutant)

    • Confirm expression by Western blotting before activity assays

    • Assess phospholipid profiles using lipidomic approaches (LC-MS/MS)

  • Substrate specificity determination: To characterize Agpat4's preference for different acyl-CoA donors and lysophospholipid acceptors:

    • Test various acyl-CoA species (varying in chain length and saturation)

    • Compare activity with different lysophospholipids (LPA, LPC, LPE, LPI)

    • Use competition assays with unlabeled substrates to determine relative affinities

These methodologies provide complementary information about Agpat4's enzymatic properties and can help resolve discrepancies between in vitro activity and in vivo functions.

What considerations are important when generating and validating Agpat4 knockout mouse models?

Generating and validating Agpat4 knockout mouse models requires careful consideration of several factors to ensure reliable and interpretable results. Based on published research, the following approach is recommended:

  • Knockout strategy design:

    • Target critical exons encoding catalytic domains to ensure complete loss of function

    • Consider potential effects on splice variants X1, X2, and X3, which have been confirmed to be endogenously expressed in various tissues

    • Design targeting constructs that minimize interference with neighboring genes

  • Validation of knockout efficiency:

    • Confirm gene deletion by PCR genotyping using primers flanking the deleted region

    • Verify absence of Agpat4 mRNA using RT-qPCR with primers targeting multiple regions

    • Confirm protein ablation by Western blotting with validated antibodies

    • Assess enzymatic activity in relevant tissues to confirm functional knockout

  • Phenotypic characterization considerations:

    • Examine multiple tissues (brain, adipose tissue depots, skeletal muscle) due to known depot-specific effects

    • Include both sexes in analyses as some phenotypes (e.g., epididymal fat expansion) show sex-specific patterns

    • Assess compensatory expression of other Agpat isoforms (Agpats 1, 2, 3, 5) and Gpat isoforms (Gpats 1, 2, 3, 4) which may confound interpretations

    • Use age-matched littermate controls to minimize genetic background effects

  • Functional assessments:

    • For cognitive function: employ Morris Water Maze testing for spatial learning and memory

    • For muscle function: analyze fiber type distribution by immunohistochemistry and force contractility by electrical stimulation

    • For adipose function: measure depot weights, conduct adipocyte morphometry, and assess lipolytic enzyme activities and phosphorylation states

Careful attention to these considerations will ensure the development of valid models that accurately reflect the physiological roles of Agpat4.

What techniques are most effective for analyzing Agpat4-dependent changes in tissue phospholipid composition?

Analyzing Agpat4-dependent changes in tissue phospholipid composition requires sophisticated techniques that can detect both global and specific alterations in the lipidome. Based on published research methodologies, the following approaches are most effective:

  • Targeted lipidomics by liquid chromatography-tandem mass spectrometry (LC-MS/MS):

    • Enables quantification of specific phospholipid species including PA, PI, PC, and PE known to be affected by Agpat4

    • Sample preparation should include extraction with chloroform/methanol (2:1 v/v) followed by phase separation

    • Internal standards for each phospholipid class should be included for accurate quantification

    • Multiple reaction monitoring (MRM) can be used to target specific phospholipid species of interest

  • Thin-layer chromatography (TLC) with radioisotope detection:

    • Useful for measuring enzymatic activity and tracking newly synthesized phospholipids

    • Can be combined with pulse-chase experiments using radiolabeled precursors (e.g., [³H]glycerol or [¹⁴C]acetate)

    • Allows visualization of major phospholipid classes and relative quantification

  • Comprehensive lipidomic profiling:

    • Shotgun lipidomics approaches can identify unexpected changes in lipid species

    • High-resolution mass spectrometry combined with multivariate statistical analysis can reveal patterns of lipid alterations

    • Particularly important when analyzing compensation by other AGPAT isoforms

  • Subcellular fractionation combined with lipid analysis:

    • Differential centrifugation to isolate organelles (mitochondria, ER, etc.)

    • Allows determination of compartment-specific phospholipid changes

    • Critical for understanding the distinct PA pools and their downstream fates in different cellular compartments

A comprehensive analytical approach combining these techniques provides the most complete understanding of how Agpat4 deficiency affects phospholipid metabolism in different tissues and subcellular compartments.

How can researchers reconcile the discrepancy between in vitro LPAAT activity and in vivo effects on specific phospholipids?

The apparent discrepancy between Agpat4's in vitro LPAAT activity (producing PA) and its in vivo effects on specific downstream phospholipids (PI, PC, PE) represents a common challenge in lipid metabolism research. This discrepancy can be reconciled through several experimental and conceptual approaches:

  • Compartmentalization hypothesis testing:

    • Conduct subcellular fractionation studies to determine Agpat4's precise localization (mitochondria have been suggested)

    • Employ proximity labeling techniques (BioID, APEX) to identify proteins in physical association with Agpat4

    • Use fluorescently tagged PA sensors to visualize PA distribution in wild-type versus Agpat4-deficient cells

    • These approaches can test the hypothesis that Agpat4-derived PA forms a distinct subcellular pool preferentially channeled to specific phospholipids

  • Metabolic flux analysis:

    • Utilize stable isotope labeling (e.g., ¹³C-glycerol) to track the fate of newly synthesized PA

    • Compare the incorporation rates into downstream phospholipids between wild-type and Agpat4-deficient tissues

    • Pulse-chase experiments can reveal altered kinetics of phospholipid synthesis pathways

    • This approach can demonstrate whether Agpat4-derived PA is preferentially directed toward specific downstream pathways

  • Protein-protein interaction studies:

    • Investigate whether Agpat4 physically interacts with enzymes involved in PI, PC, or PE synthesis

    • Co-immunoprecipitation followed by mass spectrometry can identify interaction partners

    • Functional protein complexes may explain the channeling of Agpat4-derived PA to specific pathways

  • Acyl chain profiling of phospholipids:

    • Determine if Agpat4 has preferences for specific acyl-CoA donors

    • Compare the acyl chain compositions of PA, PI, PC, and PE between genotypes

    • Specific acyl chain signatures may help trace the metabolic pathway from Agpat4-derived PA to downstream phospholipids

By integrating these approaches, researchers can develop a comprehensive model explaining how an enzyme with apparent LPAAT activity in vitro can specifically influence the levels of downstream phospholipids in vivo.

What control experiments are essential when analyzing the physiological consequences of Agpat4 deficiency?

When analyzing the physiological consequences of Agpat4 deficiency, several essential control experiments must be incorporated to ensure valid interpretations and rule out confounding factors:

These control experiments are essential for establishing causality and understanding the mechanisms underlying the observed physiological consequences of Agpat4 deficiency.

What are the most promising therapeutic applications of Agpat4 research?

Research on Agpat4 has revealed several potential therapeutic applications that warrant further investigation. Based on the documented physiological roles of Agpat4, the following areas show particular promise:

  • Cognitive enhancement and neuroprotection:

    • Agpat4 knockout mice show impaired spatial learning and memory in Morris Water Maze tests, linked to decreased brain phosphatidylinositol (PI), phosphatidylcholine (PC), and phosphatidylethanolamine (PE) content

    • These changes correlate with decreases in NMDA and AMPA receptor subunits, suggesting that Agpat4 modulation could potentially affect synaptic plasticity

    • Therapeutic strategies might involve selective enhancement of Agpat4 activity in neural tissues to maintain optimal phospholipid composition in aging or neurodegenerative conditions

  • Metabolic disorders and adipose tissue dysfunction:

    • The depot-specific effects of Agpat4 on adipose tissue expansion and lipolysis suggest potential applications in treating metabolic disorders

    • Targeting Agpat4 could potentially regulate fat distribution patterns, which is clinically relevant as different fat depots have distinct metabolic impacts

    • Modulating Agpat4 activity might help address dysfunctional lipolysis observed in conditions like obesity and insulin resistance

  • Muscle wasting and sarcopenia:

    • Agpat4's role in maintaining muscle fiber type distribution and contractile force suggests potential applications in treating muscle wasting conditions

    • Enhancing Agpat4 activity might help preserve muscle mass and function in aging or disease states

    • The connection between Agpat4 and pyruvate dehydrogenase activity points to potential metabolic interventions in muscle disorders

  • Tissue-specific phospholipid modulation:

    • The unique ability of Agpat4 to support synthesis of specific phospholipids (PI, PC, PE) could be leveraged for targeted membrane composition modification

    • This approach might be particularly valuable in conditions characterized by altered membrane phospholipid composition

Research approaches investigating these therapeutic applications should include in vitro drug screening for Agpat4 modulators, tissue-specific conditional knockout and overexpression models, and preclinical testing in disease models relevant to each application.

What unresolved questions remain about Agpat4 biology and function?

Despite significant advances in our understanding of Agpat4, several critical questions remain unresolved that represent important areas for future research:

  • Substrate specificity and regulation:

    • What determines Agpat4's apparent preference for specific acyl-CoA donors in different tissues?

    • How is Agpat4 activity regulated post-translationally (phosphorylation, acetylation, etc.)?

    • What factors control the differential expression of Agpat4 splice variants X1, X2, and X3 across tissues?

  • Subcellular localization and phospholipid channeling:

    • What is the precise subcellular localization of Agpat4 in different cell types?

    • How does Agpat4-derived PA form a distinct pool directed toward specific phospholipids?

    • What protein interactions might explain the channeling of Agpat4 products toward PI, PC, and PE synthesis?

  • Molecular mechanisms underlying physiological effects:

    • How does Agpat4 deficiency lead to decreased NMDA and AMPA receptor subunits in the brain?

    • What molecular pathways connect Agpat4 to adipose tissue lipolysis regulation?

    • How does Agpat4 influence pyruvate dehydrogenase activity and muscle fiber type determination?

  • Evolutionary and comparative aspects:

    • Why has evolutionary pressure maintained multiple AGPAT isoforms with apparently redundant enzymatic functions?

    • How do the functions of Agpat4 compare across species?

    • What are the specific roles of different Agpat4 domains in determining its unique functions?

  • Disease associations and human relevance:

    • Are AGPAT4 polymorphisms associated with specific human diseases or conditions?

    • How relevant are the mouse Agpat4 knockout phenotypes to human physiology?

    • Does AGPAT4 play a role in human cardiovascular diseases, as suggested by publication associations?

Addressing these questions will require integrated approaches combining biochemical, cellular, physiological, and computational methods to fully elucidate the complex biology of Agpat4 and its role in health and disease.

What fundamental principles of lipid metabolism have been established through Agpat4 research?

Research on Agpat4 has established several fundamental principles of lipid metabolism that extend beyond this specific enzyme to inform our broader understanding of phospholipid biosynthesis and function:

  • Metabolic channeling and pathway compartmentalization:

    • Agpat4 research has demonstrated that phosphatidic acid (PA) does not exist as a single homogeneous pool within cells, but rather forms distinct substrate pools channeled toward specific downstream products

    • This principle helps explain how cells maintain specific membrane compositions despite sharing common biosynthetic precursors

  • Tissue-specific metabolic redundancy:

    • The finding that Agpat4 deficiency produces heterogeneous effects across different tissues and even between similar adipose depots reveals important principles about metabolic redundancy

    • This work has shown that the functional significance of an enzyme depends not only on its intrinsic properties but also on the tissue-specific expression of complementary or compensatory enzymes

  • Integration of lipid metabolism with physiological function:

    • Agpat4 research has established clear links between phospholipid metabolism and diverse physiological processes including cognitive function, muscle contractility, and adipose tissue expansion

    • These connections demonstrate how specific alterations in lipid metabolism can drive broad physiological changes

  • Splice variant functionality in metabolic enzymes:

    • The discovery that Agpat4 splice variants (X1, X2, X3) are endogenously synthesized and may modulate protein function highlights the importance of alternative splicing in expanding the functional repertoire of metabolic enzymes

    • This principle suggests that splice variant analysis should be integrated into studies of other lipid metabolic enzymes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.