Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon (Agpat5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Agpat5; D8Ertd319e; 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon; 1-acylglycerol-3-phosphate O-acyltransferase 5; 1-AGP acyltransferase 5; 1-AGPAT 5; Lysophosphatidic acid acyltransferase epsilon; LPAAT-epsilon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPARLYQRVDDRLYCVYQN MVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADMLAARQDALGHVRYVLK DKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAGTPMYLVIFPEGTRYNAT YTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHLDAIYDVTVVYEGNEKGSG KYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKWLHERFEIKDRLLIEFYDSP DPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTESGRKLYMGTWLYGTLLGCLW FVIKA
Uniprot No.

Target Background

Function
This recombinant mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon (Agpat5) catalyzes the conversion of 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) to 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. It utilizes LPA containing saturated or unsaturated fatty acids (C15:0-C20:4) at the sn-1 position and C18:1-CoA as the acyl donor. The enzyme also acts on lysophosphatidylethanolamine (using oleoyl-CoA, but not arachidonoyl-CoA) and lysophosphatidylinositol (using arachidonoyl-CoA, but not oleoyl-CoA). Activity towards lysophosphatidylglycerol is undetectable.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus envelope. Mitochondrion.
Tissue Specificity
Widely expressed.

Q&A

What is the primary enzymatic function of Agpat5?

Agpat5 (also known as 1-acylglycerol-3-phosphate O-acyltransferase epsilon) primarily converts lysophosphatidic acid (LPA) to phosphatidic acid (PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. This enzyme acts on LPA containing saturated or unsaturated fatty acids C15:0-C20:4 at the sn-1 position using C18:1-CoA as the acyl donor. Unlike other AGPAT family members, Agpat5 demonstrates significant acyltransferase activity toward lysophosphatidylethanolamine (LPE) in the presence of C18:1 fatty acid .

How does the enzymatic activity of Agpat5 compare with other AGPAT isoforms?

Agpat5 has distinct kinetic parameters compared to other AGPAT isoforms. As shown in the table below, Agpat5 has a Km of 5.52 μM for LPA and a Vmax of 2.42 nmol/min/mg protein, resulting in a Vmax/Km ratio of 0.44. This differs significantly from AGPAT2, which has much higher catalytic efficiency with a Vmax/Km ratio of 100 .

SubstrateKm (µM)Vmax (nmol/min/mg protein)Vmax/Km
AGPAT3 - Acyl CoA21.530.740.04
AGPAT3 - LPA4.786.351.33
AGPAT5 - Acyl CoA16.301.220.08
AGPAT5 - LPA5.522.420.44
AGPAT10/GPAT3/AGPAT8 - Acyl-CoA2.76022
AGPAT10/GPAT3/AGPAT8 - LPA9.214.191.5
AGPAT2 - Acyl-CoA0.4210525
AGPAT2 - LPA2200100

What are the conserved motifs in the Agpat5 protein sequence?

When comparing the amino acid sequences of five murine AGPAT isoforms (mAGPATs), researchers have identified three highly conserved motifs, including a novel motif/pattern KX2LX6GX12R. These conserved regions likely play crucial roles in substrate binding and catalytic activity. Understanding these motifs can help researchers design mutation studies to probe the structure-function relationships of Agpat5 .

What is the tissue distribution pattern of Agpat5?

Unlike AGPAT1 and AGPAT3, which are ubiquitously expressed across most tissues, Agpat5 exhibits a tissue-specific expression pattern. Studies in mice have shown that mAGPAT5 has a more restricted distribution compared to other AGPAT isoforms. This distinct expression pattern suggests that Agpat5 may have specialized functions in specific tissues, which is important to consider when designing tissue-specific studies .

Where is Agpat5 localized within the cell?

In cells overexpressing Agpat5, the protein has been detected in multiple subcellular compartments, including the nuclear envelope and the endoplasmic reticulum. Notably, AGPAT5-GFP fusion protein has been specifically localized to mitochondria in both Chinese hamster ovary and human epithelial cervical cancer cells. This mitochondrial localization is particularly significant as it suggests that Agpat5 may be involved in mitochondrial phospholipid synthesis, distinguishing it from other AGPAT isoforms .

How can subcellular fractionation be used to study Agpat5 localization?

Subcellular fractionation combined with Western blot analysis is an effective method to study Agpat5 localization. Researchers can follow this protocol:

  • Collect cells overexpressing V5-tagged Agpat5 and lyse in RIPA buffer containing protease inhibitor cocktail

  • Centrifuge at 3,000 g for 10 minutes at 4°C to remove cellular debris

  • Subject the post-3,000 g supernatant to differential centrifugation to obtain fractions containing mitochondria or microsomes

  • Resolve proteins (30 μg) from each fraction on SDS-PAGE and transfer to nylon membrane

  • Detect Agpat5 using V5 antibody conjugated to horseradish alkaline phosphatase

  • Use specific markers like prohibitin for mitochondria or calnexin for microsomes to verify fraction purity

This approach enables precise determination of Agpat5's subcellular distribution and can be complemented with immunofluorescence microscopy of fluorescently tagged Agpat5 .

How can recombinant Agpat5 be generated for in vitro studies?

To generate recombinant Agpat5 for in vitro studies, researchers commonly use adenoviral expression systems. The procedure involves:

  • Amplifying the full-length open reading frame (ORF) of Agpat5 (GenBank accession number NM_018361 for human AGPAT5) using specific primers

  • Adding an epitope tag (e.g., V5) at the amino-terminus for detection

  • Cloning the amplified product into a TA-cloning vector and verifying by sequencing

  • Subcloning into an adenoviral vector (e.g., using the AdEasy adenoviral system)

  • Transfecting packaging cells to produce recombinant adenovirus

  • Infecting target cells (e.g., AD293 cells) with the recombinant adenovirus

  • Harvesting cells and preparing lysates for enzymatic assays or purification

This approach allows for high-level expression of functional Agpat5 protein suitable for biochemical and enzymatic characterization .

What are the optimal conditions for measuring Agpat5 enzymatic activity?

For accurate measurement of Agpat5 enzymatic activity, the following conditions and considerations are important:

  • Substrate preparation: Use radiolabeled substrates such as [14C]oleoyl-CoA and 1-oleoyl-LPA

  • Reaction buffer: Typically 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 1 mM DTT, and 10% glycerol

  • Protein concentration: Use 10-30 μg of cell lysate protein containing recombinant Agpat5

  • Incubation: Perform reactions at 37°C for 10-15 minutes

  • Reaction termination: Stop reactions with chloroform:methanol (2:1, v/v)

  • Analysis: Separate lipid products by thin-layer chromatography and quantify by scintillation counting

  • Kinetic parameters: Determine Km and Vmax using varying concentrations of substrates

For substrate specificity studies, different lysophospholipid acceptors (LPA, LPE, LPI, LPG) and acyl-CoA donors can be tested under these conditions to determine relative activities .

How can mouse models for studying Agpat5 function be generated?

Generation of mouse models for studying Agpat5 involves several strategic approaches:

  • Conditional knockout models:

    • Use Cre-loxP system with Agpat5[flox] strain (e.g., Jackson Laboratory strain 037843)

    • Breed with tissue-specific Cre recombinase-expressing lines for targeted deletion

    • Validate deletion by RNAscope and qPCR in target tissues

  • Cell-specific knockout models:

    • For example, AgRP neuron-specific Agpat5 knockouts can be generated by crossing Agpat5[flox] mice with AgRP-Cre lines

    • Include reporter genes (e.g., GFP) to visualize affected cells

  • Validation methods:

    • Confirm loss of Agpat5 at mRNA level by qPCR

    • Perform protein analysis by Western blotting or immunohistochemistry

    • Verify functional consequences through appropriate phenotypic assays

These models are crucial for investigating the tissue-specific roles of Agpat5 in physiological processes like energy homeostasis and glucose regulation .

How does Agpat5 contribute to hypoglycemia sensing and counterregulation?

Agpat5 plays a critical role in hypoglycemia sensing and counterregulation through its expression in agouti-related peptide (AgRP) neurons:

  • Mechanism of action:

    • Agpat5 partitions fatty acyl-CoAs away from mitochondrial fatty acid oxidation and ATP generation

    • This ensures that the fall in intracellular ATP, which triggers neuronal firing, faithfully reflects changes in glycemia

    • When inactivated, Agpat5 deficiency leads to increased fatty acid oxidation and ATP production, impairing hypoglycemia sensing

  • Physiological significance:

    • Agpat5 in AgRP neurons is required for:

      • Neuronal activation by hypoglycemia

      • Hypoglycemia-induced vagal nerve activity

      • Glucagon secretion to stimulate hepatic glucose production

  • Experimental evidence:

    • Genetic screen of recombinant inbred BXD mice identified Agpat5 as a candidate regulator of hypoglycemia-induced glucagon secretion

    • AgRP neuron-specific deletion of Agpat5 impairs counterregulatory responses

    • Suppressing Cpt1a-dependent fatty acid import into mitochondria restores hypoglycemia sensing in Agpat5-deficient neurons

This research highlights Agpat5's essential role in maintaining glucose homeostasis during hypoglycemic conditions .

What is the relationship between Agpat5 and lipid droplet regulation in neurons?

Recent research has revealed a complex relationship between Agpat5 and neuronal lipid droplet regulation:

  • In hunger-activated neurons:

    • Agpat5 influences the partitioning of fatty acyl-CoAs between storage in lipid droplets and mitochondrial oxidation

    • This partitioning affects ATP levels, which are crucial for neuronal activation during metabolic challenges

  • Comparative evidence across species:

    • In mice, Agpat5 in AgRP neurons affects food intake and energy homeostasis

    • In Drosophila, a similar mechanism exists in adipokinetic hormone (Akh)-producing cells, showing evolutionary conservation of this pathway

  • Sex differences:

    • Male mice with AgRP neuron-specific ATGL knockout show reduced body weight, fat mass, and food intake

    • Similar effects were not observed in females, suggesting sex-specific regulation

    • In Drosophila, lipid metabolism in Akh-producing cells also shows sex-specific phenotypes

These findings suggest that Agpat5-mediated lipid metabolism in specific neuronal populations plays a conserved role in whole-body energy homeostasis, with notable sex differences in these regulatory mechanisms .

How is Agpat5 expression regulated by PPARα in cardiac tissue?

Agpat5 expression in cardiac tissue is subject to regulation by the nuclear receptor PPARα (peroxisome proliferator-activated receptor alpha):

  • Experimental evidence:

    • Cardiac AGPAT activities were 25% lower (P<0.05) in PPARα null mice compared with wild-type

    • Cardiac AGPAT activities were 50% lower (P<0.05) in PPARα null mice fed the PPARα agonist clofibrate compared with clofibrate-fed wild-type animals

  • Isoform-specific regulation:

    • This modulation of AGPAT activity was accompanied by differential effects on specific AGPAT isoforms:

      • Significant enhancement of mAGPAT3 mRNA levels

      • Significant reduction of mAGPAT2 mRNA levels

    • mRNA expression of cardiac mAGPAT3 appeared to be directly regulated by PPARα activation

  • Functional implications:

    • Cardiac AGPAT activity may be regulated by both:

      • The composition of AGPAT isoforms present

      • The levels of each isoform expressed

    • This suggests a complex regulatory mechanism linking lipid metabolism, PPARα signaling, and cardiac function

These findings indicate that Agpat5 expression and activity in cardiac tissue are subject to sophisticated transcriptional control, potentially linking cardiac lipid metabolism to broader metabolic regulatory networks .

What is the significance of Agpat5 expression in colorectal cancer?

Low expression of AGPAT5 has been associated with important clinical features in colorectal cancer (CRC):

  • Clinical correlations:

    • AGPAT5 expression is significantly negatively correlated with:

      • N stage (lymph node involvement)

      • T stage (tumor size/invasion)

    • These correlations suggest that reduced AGPAT5 expression is associated with more advanced disease

  • Microsatellite instability relationship:

    • AGPAT5 expression levels were increased in microsatellite instability-high (MSI-H) CRC compared to microsatellite stable (MSS) CRC

    • This suggests a potential role in the distinct biology of MSI-H tumors, which generally have better prognosis

  • Potential as a biomarker:

    • AGPAT5 may serve as a prognostic biomarker for CRC progression

    • It could be particularly useful when considered alongside other molecules like GSR, CRLF1, and NPR3, which show similar stage-associated expression patterns

These findings suggest that altered lipid metabolism via changes in AGPAT5 expression may contribute to CRC progression, opening potential avenues for diagnostic and therapeutic approaches .

How does modulation of AGPAT5 expression impact disease processes?

Modulation of AGPAT5 expression can significantly impact various disease processes, as evidenced by research into therapeutic targeting of this enzyme:

  • Metabolic disorders:

    • Targeting AGPAT5 in AgRP neurons affects counterregulatory responses to hypoglycemia

    • This has implications for diabetes management, particularly hypoglycemia awareness and prevention

    • Modulating AGPAT5 may also influence obesity through effects on food intake and energy homeostasis

  • Cancer biology:

    • The negative correlation between AGPAT5 expression and cancer progression suggests that upregulation of AGPAT5 might suppress tumor advancement

    • The mechanism may involve alterations in membrane phospholipid composition or signaling lipid availability

  • Therapeutic approaches:

    • Antisense oligonucleotides and other nucleic acid-based approaches have been developed to modulate AGPAT5 expression

    • Patent US10364433B2 describes compounds for modulation of AGPAT5 expression with potential therapeutic applications

    • These approaches highlight the potential clinical relevance of targeting AGPAT5 in metabolic syndrome and type 2 diabetes

Understanding the disease-specific consequences of AGPAT5 modulation is crucial for developing targeted therapeutic strategies with minimal off-target effects .

How can multi-omics approaches enhance our understanding of Agpat5 function?

Implementing multi-omics approaches can provide comprehensive insights into Agpat5 function:

  • Integration of lipidomics, transcriptomics, and proteomics:

    • Lipidomics can identify specific phospholipid species affected by Agpat5 manipulation

    • Transcriptomics reveals downstream gene expression changes resulting from altered lipid metabolism

    • Proteomics can identify Agpat5 protein partners and post-translational modifications

  • Methodological considerations:

    • Use stable isotope labeling to track specific metabolic pathways affected by Agpat5

    • Apply tissue-specific and subcellular fractionation approaches to isolate compartment-specific effects

    • Combine with temporal analyses to understand dynamic responses to metabolic challenges

  • Advanced computational analysis:

    • Apply pathway enrichment tools like DAVID to interpret complex datasets

    • Use correlation analyses to identify relationships between Agpat5 expression and other molecular features

    • Develop predictive models of lipid metabolism based on Agpat5 activity levels

This multi-dimensional approach can reveal how Agpat5-mediated changes in lipid composition propagate through cellular signaling networks to affect physiological outcomes .

What are the challenges in developing isoform-specific inhibitors of Agpat5?

Developing isoform-specific inhibitors of Agpat5 presents several significant challenges:

  • Structural homology issues:

    • The AGPAT family shares conserved motifs, including the newly identified KX2LX6GX12R motif

    • This structural similarity makes selective targeting difficult

    • Crystallographic data for AGPATs is limited, hampering structure-based drug design

  • Substrate specificity considerations:

    • While Agpat5 shows preference for LPE with C18:1 fatty acid as substrate, other AGPATs have overlapping specificities

    • Targeting the substrate-binding pocket may lead to cross-reactivity with other AGPAT isoforms

    • Understanding unique aspects of Agpat5's catalytic mechanism is crucial for specificity

  • Methodological approaches to overcome these challenges:

    • High-throughput screening against recombinant Agpat5 with counter-screening against other AGPAT isoforms

    • Focused design based on unique subcellular localization (mitochondrial targeting)

    • Development of transition-state analogs specific to Agpat5's catalytic properties

    • Allosteric modulators targeting non-conserved regions of the enzyme

These strategies require detailed enzymatic characterization, structural insights, and comprehensive selectivity profiling to develop truly isoform-specific Agpat5 modulators .

How might CRISPR-based approaches advance Agpat5 research beyond traditional knockout models?

CRISPR-based technologies offer sophisticated approaches to study Agpat5 function beyond conventional knockout models:

  • Precise genome editing applications:

    • Introduction of specific point mutations to study structure-function relationships in conserved motifs

    • Creation of knock-in models expressing tagged Agpat5 at endogenous levels

    • Generation of humanized mouse models expressing human AGPAT5 variants

  • Spatiotemporal control of Agpat5 expression:

    • CRISPR interference (CRISPRi) for inducible, reversible suppression of Agpat5

    • CRISPR activation (CRISPRa) to enhance endogenous Agpat5 expression

    • Combining with optogenetic or chemogenetic systems for precise temporal control

  • High-throughput screening applications:

    • CRISPR screens to identify genetic interactors of Agpat5

    • Paired with reporter systems to monitor effects on lipid metabolism in real-time

    • Single-cell approaches to understand cell-to-cell variability in Agpat5 function

  • In vivo applications:

    • Base editing to introduce specific mutations without double-strand breaks

    • Somatic genome editing to bypass embryonic lethality of potential constitutive knockouts

    • Tissue-specific editing to complement conditional knockout approaches

These advanced CRISPR applications can provide nuanced insights into Agpat5 function that would be difficult to achieve with traditional genetic approaches .

What are the most promising future research directions for Agpat5?

Based on current knowledge and research gaps, the most promising future directions for Agpat5 research include:

  • Detailed structural biology:

    • Determination of the three-dimensional structure of Agpat5, particularly in complex with substrates

    • Investigation of conformational changes during catalysis

    • Structure-based design of specific inhibitors or modulators

  • Pathophysiological roles:

    • Further exploration of Agpat5's role in metabolic disorders beyond hypoglycemia

    • Investigation of Agpat5 in additional cancer types and progression mechanisms

    • Study of potential involvement in neurodegenerative disorders given its role in neuronal function

  • Therapeutic targeting:

    • Development of tissue-specific delivery systems for Agpat5 modulators

    • Exploration of small molecule modulators with increased specificity

    • Investigation of combinatorial approaches targeting multiple lipid metabolism enzymes

  • Regulatory networks:

    • Comprehensive characterization of transcriptional and post-transcriptional regulation of Agpat5

    • Investigation of how Agpat5 activity is regulated by metabolic signals

    • Systems biology approaches to place Agpat5 within broader metabolic networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.