Recombinant Mouse 12- (S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Forms

Gene NamesHost SystemsPurityReactivityReferences
Gpr31cE. coli, Baculovirus, Mammalian≥85% (SDS-PAGE)Mouse
Gpr31bCell-Free Expression≥85% (SDS-PAGE)Mouse
Partial Gpr31cE. coli/Yeast/Mammalian≥85% (SDS-PAGE)Mouse

Partial constructs (e.g., D17Leh66b region) are used to study domain-specific interactions .

Inflammation and Vascular Regulation

  • Thromboxane Antagonism: 12(S)-HETE and its enantiomer 12(R)-HETE act as competitive antagonists of thromboxane A2 (TXA2) receptors, promoting vasodilation in pre-constricted arteries .

  • Pro-inflammatory Activity: 12(S)-HETE is linked to inflammation in cancer microenvironments, enhancing tumor cell survival and metastasis .

Cancer Progression

MechanismPathwayCancer TypeImpactReferences
VEGF InductionMAPK/ERK and NFκB pathwaysProstate (PC3/LNCaP)Angiogenesis
ProliferationRetinoblastoma protein phosphorylationProstate (PC3)Cell cycle progression
Apoptosis Resistance12-LO inhibition reversalProstate (DU145)Survival advantage

Nuclear Signaling

The 50-kDa ligand-binding subunit interacts with SRC-1, a coactivator for steroid receptors. This interaction occurs via:

  1. Nuclear Receptor Interaction Domain (amino acids 701–781): Contains LXXLL motifs critical for SRC-1 binding .

  2. N-Terminal Domain (amino acids 1–221): Weak binding to steroid receptors, suggesting a unique signaling mode .

Research Applications and Tools

  • ELISA Kits: Quantify 12-HETE levels in mouse and rat samples (detection range: 0.5–100 ng/mL) .

  • Functional Studies: Used to investigate GPCR signaling, receptor antagonism, and cancer metastasis .

Therapeutic Implications

Targeting GPR31/Gpr31c may offer strategies to:

  • Inhibit Metastasis: Block 12(S)-HETE-induced VEGF expression in prostate cancer .

  • Modulate Inflammation: Leverage thromboxane antagonism for vascular diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you require a specific format, please indicate your preference in the order remarks. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery times, please consult your local distributor.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Gpr31; Gpr31b; Gpr31c; 12-(S-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12-(S-HETE receptor; 12-HETER; G-protein coupled receptor 31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MERTNCSAASTVVETAVGTMLTLECVLGLMGNAVALWTFFYRLKVWKPYAVYLFNLVVAD LLLATSLPFFAAFYLKGKTWKLGHMPCQVLLFLLAFSRGVGVAFLTTVALDRYLRVVHPR LRVNLLSLRAAWGISSLIWLLMVVLTPQNLLTCRTTQNSTECPSFYPTGGAKAIATCQEV LFFLQVLLPFGLISFCNSGLIRTLQKRLRESDKQPRIRRARVLVAIVLLLFGLCFLPSVL TRVLVHIFQEFKSCSVQQAIVRASDIAGSLTCLHSTLSPAIYCFSNPAFTHSYRKVLKSL RGRRKAAESPSDNLRDSYS
Uniprot No.

Target Background

Function
This receptor exhibits high affinity for 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (12-S-HETE), with significantly lower affinities for other HETE isomers. 12-S-HETE is a eicosanoid, a 12-lipoxygenase (ALOX12) metabolite of arachidonic acid, involved in a wide range of physiological and pathological processes, including cell growth, adhesion, inflammation, and cancer promotion. Binding of 12-S-HETE activates the ERK1/2 (MAPK3/MAPK1), MEK, and NF-kappa-B pathways, ultimately leading to cell growth. This receptor plays a crucial role in the proliferation, survival, and macropinocytosis of KRAS-dependent cancer cells by mediating the translocation of KRAS from the endoplasmic reticulum to the plasma membrane (PM) and its association with the PM. It contributes to enhanced immune responses by inducing dendrite protrusion of small intestinal CX3CR1(+) phagocytes for the uptake of luminal antigens. Additionally, it acts as a key receptor for 12-(S)-HETE-mediated liver ischemia reperfusion injury. It is also a proton-sensing G protein-coupled receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is 12(S)-HETE and how is it produced in mouse models?

12(S)-HETE (12(S)-hydroxy-5,8,10,14-eicosatetraenoic acid) is a bioactive lipid mediator derived from arachidonic acid through the action of 12-lipoxygenase enzymes. In mice, 12(S)-HETE is predominantly produced by the enzymatic action of arachidonate 12-lipoxygenase (encoded by the ALOX12 gene), which is primarily expressed in platelets and skin. This enzyme specifically catalyzes the conversion of arachidonic acid to 12(S)-hydroperoxy-5Z,8Z,10E,14Z-eicosatetraenoic acid (12(S)-HpETE), which is subsequently reduced to 12(S)-HETE.

The biosynthetic pathway is stereospecific, producing the S-enantiomer through platelet-type 12-lipoxygenase, which should be distinguished from the R-enantiomer (12(R)-HETE) that is generated through different enzymatic pathways involving 12R-lipoxygenase (ALOX12B) in other tissues. These distinct biosynthetic routes have significant implications for downstream signaling and biological effects.

How does 12(S)-HETE differ structurally and functionally from other eicosanoids?

12(S)-HETE possesses a distinct molecular structure characterized by a hydroxyl group at carbon 12 and a specific 5Z,8Z,10E,14Z cis-trans configuration in its four double bonds. This precise stereochemistry is critical for its biological activity and receptor interactions. Unlike prostanoids that signal through dedicated G-protein coupled receptors, 12(S)-HETE functions primarily as a local autocrine or paracrine signaling agent, regulating the behavior of its cells of origin or nearby cells, respectively.

A key functional distinction of 12(S)-HETE is its specific vascular activity profile. Research demonstrates that 12(S)-HETE selectively relaxes blood vessels preconstricted with thromboxane analogs (such as U46619) and prostaglandins (PGF2α), but notably not those constricted with adrenergic agonists like phenylephrine. This selectivity indicates a specialized interaction with thromboxane-mediated signaling pathways rather than a broad vasodilatory effect.

What are the optimal methods for isolating and measuring 12(S)-HETE in mouse tissue samples?

For reliable isolation and measurement of 12(S)-HETE in mouse tissue samples, a multi-step chromatographic approach is recommended. Beginning with tissue homogenization in an appropriate buffer containing antioxidants, researchers should extract lipids using a modified Bligh-Dyer method with chloroform/methanol. The extracts should then undergo solid-phase extraction on C18 columns before analysis.

For precise stereoisomer identification, a combination of normal phase, reverse phase, and chiral HPLC is essential, as demonstrated in published protocols. This three-step chromatographic approach allows for the unambiguous identification of 12(S)-HETE versus its 12(R) enantiomer. Mass spectrometry, particularly liquid chromatography-tandem mass spectrometry (LC-MS/MS), provides superior sensitivity and specificity for quantification of 12(S)-HETE at physiologically relevant concentrations.

When designing experiments, researchers should be aware that sample handling can significantly affect measurements due to the oxidative instability of eicosanoids. Immediate flash-freezing of tissues in liquid nitrogen, inclusion of antioxidants in extraction buffers, and processing under nitrogen atmosphere are critical methodological considerations to prevent artifactual oxidation.

What experimental models are most appropriate for studying 12(S)-HETE receptor function in mice?

For investigating 12(S)-HETE receptor functions, several experimental models have proven valuable. Isolated vessel preparations, particularly from mouse mesenteric arteries, allow for the direct assessment of vasoactive properties through myography. This ex vivo approach enables precise control of concentrations and can reveal tissue-specific responses to 12(S)-HETE.

For cellular signaling studies, primary mouse cells expressing relevant pathways (endothelial cells, platelets, keratinocytes) or immortalized cell lines derived from these tissues are recommended. When establishing such models, researchers should validate the expression of key enzymes (ALOX12) and putative receptor systems through qPCR and Western blotting to ensure physiological relevance.

Does 12(S)-HETE act through a dedicated receptor or via multiple signaling pathways?

Current evidence indicates that 12(S)-HETE does not act through a single dedicated receptor but rather engages multiple signaling systems in a context-dependent manner. Unlike classical eicosanoids such as prostaglandins and leukotrienes that have specific G-protein coupled receptors, 12(S)-HETE appears to modulate cellular functions through diverse mechanisms.

In vascular tissues, 12(S)-HETE exerts its relaxation effects by interacting with thromboxane receptor-mediated pathways. This is evidenced by its selective ability to relax vessels preconstricted with thromboxane analogs and prostaglandins, but not those constricted with phenylephrine. This suggests an antagonistic or modulatory effect on thromboxane signaling rather than activation of a dedicated vasodilatory receptor.

Research should focus on investigating multiple potential mechanisms, including:

  • Direct modulation of thromboxane receptor signaling

  • Interaction with nuclear receptors, similar to the 12(R)-HETE interaction with AHR

  • Metabolic conversion to more active derivatives with distinct receptor profiles

  • Alterations in membrane properties affecting multiple signaling platforms

How do 12(S)-HETE and 12(R)-HETE differ in their receptor interactions and signaling outcomes?

The stereoisomers 12(S)-HETE and 12(R)-HETE demonstrate significant differences in their biological activities and receptor interactions, highlighting the importance of stereochemistry in eicosanoid signaling. While both isomers can induce vascular relaxation in mouse models, 12(R)-HETE exhibits greater potency than 12(S)-HETE in relaxing U46619-preconstricted vessels (maximum relaxations of 91.4±2.7% versus 71.8±5.9%, respectively).

A major distinction between these isomers lies in their interaction with the aryl hydrocarbon receptor (AHR) pathway. 12(R)-HETE acts as a potent indirect modulator of AHR signaling, activating AHR-mediated transcription even at nanomolar concentrations in human cell lines. In contrast, structurally similar HETE isomers, including 12(S)-HETE, fail to demonstrate significant activation of the AHR pathway.

Experimental approaches to distinguish these distinct signaling mechanisms should include:

  • Parallel testing of both isomers in the same experimental system

  • Use of stereoisomer-specific antagonists when available

  • Examination of downstream signaling events unique to each pathway

  • Transcriptomic analysis to identify differential gene expression patterns

What is the role of 12(S)-HETE in regulating vascular function in mice?

12(S)-HETE serves as an important endothelium-derived mediator that participates in regulating vascular tone through specific mechanisms. Research demonstrates that 12(S)-HETE preferentially relaxes blood vessels preconstricted with thromboxane and prostaglandin analogs, including U46619, carbocyclic thromboxane A2, PGF2α, and 8-iso PGF2α. Importantly, this effect shows selectivity, as 12(S)-HETE does not relax phenylephrine-preconstricted vessels.

This selectivity suggests a complex interplay between 12(S)-HETE and thromboxane signaling pathways in vascular regulation. Pretreatment with either 12(S)- or 12(R)-HETE (1 μM) inhibits subsequent constrictions induced by thromboxane analog U46619, indicating a protective mechanism against excessive thromboxane-mediated vasoconstriction. This observation has significant implications for conditions involving thromboxane-mediated vascular dysfunction, such as thrombosis, hypertension, and various inflammatory states.

To fully characterize this vascular role, researchers should investigate:

  • Regional differences in vascular responsiveness to 12(S)-HETE

  • Interaction with endothelium-derived relaxing factors (NO, prostacyclin)

  • Altered responses in disease models (hypertension, diabetes, atherosclerosis)

  • Sex-specific differences in 12(S)-HETE vascular signaling

How does 12(S)-HETE contribute to inflammatory processes in mouse models?

12(S)-HETE participates in multiple aspects of inflammatory signaling, functioning as both a mediator and regulator of inflammatory responses. In contrast to the pro-inflammatory effects often associated with eicosanoids, evidence suggests that 12(S)-HETE and related hydroperoxy-eicosatetraenoic acids (HPETEs) may exert anti-inflammatory effects by inhibiting pro-inflammatory cytokine production.

Research has demonstrated that 15-HPETE (a related eicosanoid) inhibits TNF-α mRNA production in a concentration-dependent manner in macrophage cell models. While the data specifically addressed 15-HPETE, the structural and functional similarities suggest that 12(S)-HETE might share similar immunomodulatory properties. The inhibitory effect occurs upstream of TNF-α gene transcription, potentially by interfering with protein kinase C (PKC) translocation—a critical step in LPS-induced macrophage activation.

For researchers investigating 12(S)-HETE in inflammatory contexts, several methodological approaches are recommended:

  • Measure cytokine production in primary macrophages or dendritic cells exposed to 12(S)-HETE

  • Assess neutrophil and monocyte migration in response to 12(S)-HETE gradients

  • Examine effects on adhesion molecule expression in endothelial cells

  • Investigate 12(S)-HETE production during different phases of inflammatory responses

What are the current challenges in developing specific 12(S)-HETE receptor modulators for experimental use?

Developing specific modulators for 12(S)-HETE signaling presents significant challenges due to the complex and multifaceted nature of its biological activity. Unlike classical transmembrane receptors with well-defined binding pockets, 12(S)-HETE appears to interact with multiple signaling systems, making targeted drug design particularly difficult.

Several specific obstacles researchers face include:

  • The absence of a dedicated high-affinity receptor with known structure

  • The structural similarity between 12(S)-HETE and other eicosanoids, complicating selective targeting

  • The potential for off-target effects on related lipid signaling pathways

  • The context-dependent nature of 12(S)-HETE signaling across different tissue types

Innovative approaches to overcome these challenges should include:

  • Structure-activity relationship studies with modified 12(S)-HETE analogs

  • High-throughput screening against functional outcomes rather than binding assays

  • Development of targeted delivery systems for tissue-specific modulation

  • Combination approaches targeting multiple points in the 12(S)-HETE signaling cascade

How can transcriptomic and proteomic approaches advance our understanding of 12(S)-HETE receptor signaling?

Modern omics technologies offer powerful approaches to decipher the complex signaling networks engaged by 12(S)-HETE. Rather than focusing solely on identifying a single receptor, these methods can reveal the comprehensive cellular response to 12(S)-HETE stimulation, illuminating downstream pathways and regulatory networks.

For transcriptomic analysis, RNA-seq of tissues or cells treated with 12(S)-HETE can identify differentially expressed genes compared to vehicle controls. This approach revealed that 12(R)-HETE activates AHR-mediated transcription, and similar analyses with 12(S)-HETE could identify its unique transcriptional signature. Time-course experiments are particularly valuable for distinguishing primary from secondary responses.

Proteomic and phosphoproteomic analyses can identify rapid post-translational modifications induced by 12(S)-HETE, potentially revealing immediate signaling events that precede transcriptional changes. Methodologically, stable isotope labeling approaches (SILAC) or tandem mass tag (TMT) labeling offer quantitative assessments of protein abundance and modification states.

Integration of multiple omics datasets through systems biology approaches can identify key nodes and regulatory hubs in 12(S)-HETE signaling networks. These computational methods are particularly valuable for identifying potential therapeutic targets or biomarkers associated with 12(S)-HETE function.

What is the relationship between 12(S)-HETE and the aryl hydrocarbon receptor pathway in mouse models?

While 12(R)-HETE has been established as a potent indirect modulator of the aryl hydrocarbon receptor (AHR) pathway, the relationship between 12(S)-HETE and AHR signaling requires further investigation. The current evidence indicates significant stereospecificity in this interaction, as 12(R)-HETE activates AHR-mediated transcription even at nanomolar concentrations, while structurally similar HETE isomers, likely including 12(S)-HETE, do not demonstrate significant AHR activation.

This stereospecificity presents intriguing questions about the structural requirements for eicosanoid-AHR interactions. Electrophoretic mobility shift assays and ligand competition binding experiments have demonstrated that 12(R)-HETE does not directly bind or activate AHR in vitro, suggesting the involvement of metabolic conversion or co-factor recruitment. Testing whether 12(S)-HETE undergoes similar indirect mechanisms of action would provide valuable insights into the stereochemical requirements of this signaling pathway.

For researchers investigating this relationship, several methodological approaches are recommended:

  • Comparative xenobiotic-responsive element-driven luciferase reporter assays with both stereoisomers

  • Quantitation of AHR target gene induction by qPCR following 12(S)-HETE treatment

  • Metabolomic analysis to identify potential active metabolites

  • ChIP-seq analysis to map genome-wide AHR binding patterns after treatment

How do genetic variations in 12-lipoxygenase affect 12(S)-HETE signaling in different mouse strains?

Genetic diversity in 12-lipoxygenase enzymes across mouse strains can significantly impact 12(S)-HETE production and subsequent signaling pathways. These strain-dependent differences may explain contradictory findings in mouse models and have important implications for translational research.

Key methodological considerations for researchers include:

  • Quantitative comparison of basal and stimulated 12(S)-HETE levels across common laboratory mouse strains (C57BL/6, BALB/c, 129Sv, etc.)

  • Sequencing of the Alox12 gene from different strains to identify polymorphisms affecting enzyme activity or regulation

  • Analysis of tissue-specific expression patterns of Alox12 and potential receptor systems

  • Cross-strain transplantation experiments to distinguish genetic from environmental factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.