Recombinant Mouse 2-acylglycerol O-acyltransferase 1 (Mogat1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Mogat1; Dgat2l1; 2-acylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; MGAT1; Diacylglycerol acyltransferase 2-like protein 1; Monoacylglycerol O-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mogat1
Target Protein Sequence
MMVEFAPLNTPLARCLQTAAVLQWVLSFLLLVQVCIGIMVMLVLYNYWFLYIPYLVWFYY
DWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLDPGHNYIFGFHPHGIFVPGAFG
NFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSNGPVSVSKESLSHVLSKDGGGN
VSIIVLGGAKEALEAHPGTFTLCIRQRKGFVKMALTHGASLVPVFSFGENDLYKQINNPK
GSWLRTIQDAMYDSMGVALPLIYARGIFQHYFGIMPYRKLIYTVVGRPIPVQQTLNPTSE
QIEELHQTYLEELKKLFNEHKGKYGIPEHETLVFK
Uniprot No.
Target Background
Function
Recombinant Mouse 2-acylglycerol O-acyltransferase 1 (Mogat1) catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Its involvement in dietary fat absorption in the small intestine is likely minimal.
Gene References Into Functions
- Studies demonstrate that chronic ethanol consumption activates peroxisome proliferator-activated receptor gamma (PPARγ) and its target gene, monoacylglycerol O-acyltransferase 1 (MGAT1). PMID: 27404390
- Research suggests a minimal, if any, role for MOGAT1 in hepatic triacylglycerol (TAG) synthesis. PMID: 26880786
- Inactivation of hepatic MGAT activity, significantly elevated in obese mice, improved glucose tolerance and hepatic insulin signaling. This improvement was independent of changes in body weight, intrahepatic DAG and TAG content, and PKC signaling. PMID: 24595352
- MGAT1 has been identified, and its biochemical characteristics and tissue distribution have been reported. PMID: 12077311
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed at high level in kidney and stomach. Expressed at lower level in brown and white adipose tissue, uterus and liver. Not detected in small intestine.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
