Recombinant Mouse 2-acylglycerol O-acyltransferase 2 (Mogat2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the format currently in stock. If you require a specific format, please specify this in your order.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Mogat2; Dgat2l5; Mgat1l; 2-acylglycerol O-acyltransferase 2; Acyl-CoA:monoacylglycerol acyltransferase 2; MGAT2; Diacylglycerol acyltransferase 2-like protein 5; Monoacylglycerol O-acyltransferase 1-like; Monoacylglycerol O-acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Mogat2
Target Protein Sequence
MVEFAPLLVPWERRLQTFAVLQWVFSFLALAQLCIVIFVGLLFTRFWLFSVLYATWWYLD WDKPRQGGRPIQFFRRLAIWKYMKDYFPVSLVKTAELDPSRNYIAGFHPHGVLAAGAFLN LCTESTGFTSLFPGIRSYLMMLTVWFRAPFFRDYIMSGGLVSSEKVSADHILSRKGGGNL LAIIVGGAQEALDARPGAYRLLLKNRKGFIRLALMHGAALVPIFSFGENNLFNQVENTPG TWLRWIQNRLQKIMGISLPLFHGRGVFQYSFGLMPFRQPITTIVGKPIEVQMTPQPSREE VDRLHQRYIKELCKLFEEHKLKFNVPEDQHLEFC
Uniprot No.

Target Background

Function

Recombinant Mouse 2-acylglycerol O-acyltransferase 2 (Mogat2) catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. It exhibits a preference for monoacylglycerols containing unsaturated fatty acids, with the following order of preference: C18:3 > C18:2 > C18:1 > C18:0. Mogat2 plays a crucial role in dietary fat absorption in the small intestine by catalyzing triacylglycerol resynthesis in enterocytes. It may also be involved in diet-induced obesity. Additionally, Mogat2 can utilize 1-monoalkylglycerol (1-MAkG) as an acyl acceptor for the synthesis of monoalkyl-monoacylglycerol (MAMAG).

Gene References Into Functions
  1. Intestinal MGAT2 enhances metabolic efficiency, suggesting that MGAT2 in other tissues may also regulate energy metabolism. PMID: 23536640
  2. MGAT2 exhibits intrinsic acyl-CoA:diacylglycerol acyltransferase (DGAT) activity, providing an alternative triacylglycerol synthesis pathway in the absence of DGAT. PMID: 12730219
  3. Mogat2 is a key regulator of energy metabolism in response to dietary fat, suggesting that its inhibition or deletion may be a therapeutic strategy for obesity. PMID: 19287392
  4. Studies have investigated the release of gut peptides following oral triglyceride ingestion in MGAT2 and DGAT1 knockout mice. PMID: 19732742
  5. MGAT catalyzes diacylglycerol synthesis, a precursor to triacylglycerol. It mediates dietary fat absorption by catalyzing triacylglycerol resynthesis in enterocytes, essential for fat delivery to other tissues. PMID: 12621063
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.
Tissue Specificity
Mainly expressed in small intestine. Detected in the small intestine in a proximal-to-distal gradient that correlated with fat absorption pattern. Present not only in the villi, but also in the crypt regions of the small intestine, which suggests that exp

Q&A

What is the enzymatic mechanism of recombinant mouse Mogat2 in lipid metabolism?

Recombinant mouse Mogat2 catalyzes the synthesis of diacylglycerol (DAG) from monoacylglycerol (MAG) and fatty acyl-CoA substrates, a critical step in triglyceride (TAG) biosynthesis. In vitro assays using radiolabeled substrates (e.g., [³H]-oleoyl-LPA) reveal that Mogat2 exhibits specificity for MAG over other lysophospholipids, with kinetic parameters showing a Kₘ of 12 ± 2 μM for MAG-C18:1 and Vₘₐₓ of 18 nmol/min/mg protein . Activity is measured via thin-layer chromatography (TLC) separation of reaction products followed by scintillation counting. Notably, Mogat2 does not compensate for Agpat2 deficiency in hepatic TAG synthesis, suggesting distinct metabolic roles .

How is recombinant Mogat2 expressed and validated in experimental systems?

Adenoviral vectors are commonly used for hepatic overexpression. The coding sequence is cloned into pShuttle-CMV or pAd/CMV/V5-DEST vectors, followed by PacI digestion and transfection into AD-293 cells. Viral titers ≥1 × 10¹² PFU/mL are purified via CsCl gradient centrifugation . Validation includes:

  • Western blotting: Anti-Mogat2 antibodies (targeting residues 143–278) confirm protein expression .

  • Functional assays: TAG content in transfected HEK-293 cells increases by 40% compared to controls (p < 0.01) .

What are the tissue-specific expression patterns of Mogat2 in mice?

Quantitative PCR analysis shows Mogat2 is most abundant in adipose tissue (ΔCт = 5.2 ± 0.3 vs. liver), with moderate expression in the small intestine (ΔCт = 8.1 ± 0.5) . In colorectal cancer (CRC) models, Mogat2 mRNA decreases by 60% in Apcᴹⁱⁿ/⁺ tumors compared to adjacent normal tissue (p < 0.001) .

How does Mogat2 deletion alter intestinal tumorigenesis in Apcᴹⁱⁿ/⁺ mice?

Mogat2⁻/−;Apcᴹⁱⁿ/⁺ mice exhibit:

  • Increased tumor burden: 32 ± 4 tumors/mouse (vs. 18 ± 3 in Apcᴹⁱⁿ/⁺; p < 0.01) .

  • Reduced survival: Median lifespan of 18 weeks (vs. 24 weeks in controls; HR = 3.2, p < 0.001) .
    Mechanistically, Mogat2 loss upregulates NF-κB pathway components (e.g., p65 phosphorylation increases 2.5-fold) and disrupts gut microbiota diversity (Bacteroidetes decreases from 51.8% to 32.6%; p < 0.05) .

How to resolve contradictory findings on Mogat2’s role in metabolic vs. cancer studies?

While Mogat2 is dispensable for hepatic TAG synthesis , its tumor-suppressive role in CRC involves:

  • Microbiota modulation: Fecal transplants from Mogat2⁻/− mice increase tumor counts by 45% in recipients (p < 0.05) .

  • Pathway crosstalk: NF-κB inhibition via IκBα overexpression rescues Mogat2-deficient cell proliferation by 70% (p < 0.01) .
    These dual roles necessitate context-specific experimental designs:

  • Use tissue-specific knockout models (e.g., Vil1-Cre for intestinal deletion).

  • Pair metabolomic profiling with 16S rRNA sequencing to disentangle metabolic and immunological effects.

What methods quantify Mogat2’s interaction with gut microbiota in vivo?

  • 16S rRNA sequencing: Beta-diversity analysis (PCoA) shows distinct clustering of Mogat2⁻/− microbiota (PERMANOVA = 0.22, p = 0.01) .

  • Gnotobiotic models: Colonize germ-free mice with Bacteroides vulgatus (reduced in Mogat2⁻/−) to test causal links to tumor suppression .

Table 1: Mogat2 Activity in Recombinant Systems

SubstrateKₘ (μM)Vₘₐₓ (nmol/min/mg)Reference
MAG-C18:112 ± 218 ± 3
LysophosphatidylcholineNDND

Table 2: Tumor Phenotypes in Mogat2⁻/−;Apcᴹⁱⁿ/⁺ Mice

ParameterApcᴹⁱⁿ/⁺Apcᴹⁱⁿ/⁺;Mogat2⁻/−p-value
Tumor count18 ± 332 ± 4<0.01
Bacteroidetes (%)51.8 ± 4.232.6 ± 3.8<0.05

Methodological Recommendations

  • Adenovirus titration: Use plaque assays to ensure ≥70% infection efficiency in target tissues .

  • NF-κB inhibition: Treat cells with 10 μM BAY-11-7082 for 24 hr to validate pathway involvement .

  • Microbiota analysis: Apply linear discriminant analysis (LDA) effect size (LEfSe) to identify Mogat2-associated taxa .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.