Recombinant Mouse 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for customers.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Ugt8; Cgt; Ugt4; Ugt8a; 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; Ceramide UDP-galactosyltransferase; Cerebroside synthase; UDP-galactose-ceramide galactosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-541
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ugt8
Target Protein Sequence
AKIIIVPPIMFESHLYIFKTLASALHERGHHTVLLLSEGRDIAPSNHYSLQRYPGIFNST TSDAFLQSKMRNIFSGRLTAVELVDILDHYTKNCDMMVGNQALIQGLKKEKFDLLLVDPN DMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNFLERMKNTGVY LISRIGVSFLVLPKYERIMQKYNLLPAKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVY VGGILTKPASPLPEDLQRWVSGAQEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVI WRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIRAFLSHGGLNSIFETMYHGVPVVGIPLF GDHYDTMTRVQAKGMGILLEWNTVTEGELYDALVKVINNPSYRQRAQKLSEIHKDQPGHP VNRTTYWIDYILRHDGARHLRSAVHQISFCQYFLLDIAFVLLLGAVLLYFILSYVTKFIY RKIKSLWSKNEHSTVNGHYQNGIRNGKYKGNGRVKHEKKVR
Uniprot No.

Target Background

Function
Recombinant Mouse 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8) catalyzes the transfer of galactose to ceramide, a critical step in galactocerebroside biosynthesis. Galactocerebrosides are abundant sphingolipids comprising the myelin membrane of the central and peripheral nervous systems. This enzyme galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides.
Gene References Into Functions
  1. Our research indicates that additional deletion of Fa2h does not significantly affect the phenotype of Cgt-/- mice. This suggests that HFA-GlcCer and HFA-sphingomyelin do not functionally compensate for the absence of HFA-GalCer in Cgt-/- mice. PMID: 21366909
  2. This study offers new insights into the alterations in myelin protein composition and distribution in mice lacking ceramide galactosyltransferase. PMID: 19878436
  3. Our findings demonstrate that the loss of CGT in oligodendrocytes is solely responsible for the myelin structural defects, demyelination, and behavioral abnormalities observed in CGT-deficient mice. PMID: 15968630
Database Links
Protein Families
UDP-glycosyltransferase family
Subcellular Location
Membrane; Single-pass membrane protein. Endoplasmic reticulum.

Q&A

What is Recombinant Mouse 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Ugt8)?

Recombinant Mouse UGT8 is an engineered form of the natural enzyme 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (EC 2.4.1.45), which belongs to the family of glycosyltransferases, specifically hexosyltransferases . This enzyme catalyzes the transfer of galactose from UDP-galactose to 2-(2-hydroxyacyl)sphingosine, producing UDP and 1-(beta-D-galactosyl)-2-(2-hydroxyacyl)sphingosine . The recombinant form is produced through molecular cloning and expression of the mouse Ugt8 gene in suitable host systems for research applications. UGT8 is also known by several other names including galactoceramide synthase, UDP-galactose:ceramide galactosyltransferase, and others .

What enzymatic reactions does UGT8 catalyze in biological systems?

UGT8 catalyzes multiple enzymatic reactions in biological systems:

  • Primary reaction: UDP-galactose + 2-(2-hydroxyacyl)sphingosine → UDP + 1-(beta-D-galactosyl)-2-(2-hydroxyacyl)sphingosine

  • MGDG synthesis: UGT8 functions as a monogalactosyl diacylglycerol (MGDG) synthase in mammals, transferring galactose to diacylglycerol

  • Ether-linked MGDG synthesis: UGT8 shows preferential activity toward ether-linked diacylglycerol (O-16:0_16:0) as a substrate compared to regular diacylglycerol

The enzyme shows substrate preferences toward saturated fatty acids when producing MGDG, which has implications for membrane organization and cellular signaling pathways .

Where is UGT8 localized within mammalian cells?

UGT8 is predominantly localized to the endoplasmic reticulum (ER) in mammalian cells . This localization is consistent with its role in lipid metabolism and membrane organization. The ER localization is significant because:

  • It positions UGT8 at a critical site for lipid biosynthesis

  • It enables UGT8 to influence ER membrane properties

  • It allows UGT8 to participate in ER stress responses and the unfolded protein response (UPR)

  • It facilitates the integration of newly synthesized galactolipids into membrane systems

This subcellular localization has been confirmed through immunofluorescence microscopy and subcellular fractionation techniques in multiple studies .

What are the optimal methods for expressing and purifying recombinant mouse UGT8?

Based on research protocols, the following methodological approach is recommended for expressing recombinant mouse UGT8:

  • Vector design: C-terminal tagging (e.g., FLAG tag) is preferable to N-terminal tagging since mouse UGT8 undergoes N-terminal cleavage between the 20th and 21st amino acid residues . This processing affects protein detection when using N-terminal tags.

  • Expression system: Mammalian expression systems (such as HEK293T cells) yield functional enzyme. Studies have successfully used transient transfection with C-terminal FLAG-tagged UGT8 constructs .

  • Transfection protocol: Lipid-based transfection reagents show good efficiency for UGT8 expression. Allow 24-48 hours post-transfection for optimal protein expression .

  • Protein detection: Western blotting using anti-UGT8 antibodies or anti-tag antibodies (for C-terminal tags) can confirm expression. The expected molecular weight should account for any post-translational modifications .

  • Activity verification: Functional testing through measurement of galactolipid products using LC-QTOF-MS demonstrates enzyme activity in both cellular and in vitro contexts .

How can UGT8 enzymatic activity be reliably measured?

UGT8 activity can be measured through several complementary approaches:

  • Lipidomic analysis via LC-QTOF-MS:

    • This method allows for comprehensive profiling of MGDG, ether-linked MGDG, and HexCer products

    • Sample preparation involves lipid extraction from cells or tissues

    • Chromatographic separation followed by mass spectrometry detection provides quantitative measurement of specific lipid species

    • This technique can detect endogenous levels of MGDG in HeLa cells and other systems

  • In vitro enzyme assays:

    • Cell lysates from UGT8-expressing cells display MGDG biosynthetic activity

    • The assay requires UDP-galactose as donor and appropriate lipid substrates (diacylglycerol or ceramide)

    • Product formation can be monitored by LC-MS or thin-layer chromatography

  • Mutagenesis studies:

    • Site-directed mutagenesis of key residues (e.g., His358 within the UGT signature sequence) can be used to validate enzyme activity

    • Comparison of wild-type and mutant UGT8 provides insights into structure-function relationships

What experimental approaches are effective for investigating UGT8 function in cells?

Several methodological approaches have proven effective for studying UGT8 function:

  • CRISPR/Cas9-mediated knockout:

    • Complete elimination of UGT8 expression allows assessment of phenotypic consequences

    • In HeLa cells, UGT8 knockout leads to complete depletion of cellular MGDG

    • This approach enables clean assessment of UGT8-dependent processes

  • siRNA-mediated knockdown:

    • Multiple siRNAs targeting different regions of UGT8 mRNA should be used to ensure specificity

    • Western blotting confirms protein reduction

    • In HeLa cells, UGT8 knockdown reduces MGDG content by approximately 92.8% and ether MGDG by 80.7%

  • Pharmacological inhibition:

    • UGT8 inhibitors can be used to acutely suppress enzyme activity

    • Inhibitors have been used to reduce MGDG content in mouse tissues, confirming UGT8's role as an MGDG synthase in mammals

  • Overexpression studies:

    • Transient overexpression of tagged UGT8 enhances MGDG production in cells

    • Mouse and human UGT8 show comparable enzymatic activities when expressed in HeLa cells

    • This approach can be used to rescue phenotypes in knockout cells or to study the effects of increased UGT8 activity

How is UGT8 expression associated with cancer progression?

UGT8 has been identified as a significant marker of cancer aggressiveness, particularly in breast cancer:

  • Expression patterns in primary tumors vs. metastases:

    • UGT8 expression is significantly higher in metastatic tumors compared to primary tumors (p<0.05)

    • Lung metastases consistently show stronger UGT8 immunostaining than their matched primary breast tumors

  • Association with tumor grade:

    • UGT8 expression correlates with tumor malignancy grade, with significantly higher expression in G3 tumors compared to G2 (p<0.01) and G1 (p<0.001)

    • This pattern suggests UGT8 may play a role in tumor dedifferentiation and aggressive behavior

  • Correlation with nodal status:

    • Node-positive tumors express significantly higher levels of UGT8 than node-negative tumors (p<0.001)

    • This association supports UGT8's potential role in metastatic processes

  • Validation at mRNA level:

    • The predictive ability of increased UGT8 expression has been validated at the mRNA level across three independent cohorts of breast cancer patients (totaling 721 patients)

    • This multi-cohort validation strengthens the evidence for UGT8 as a prognostic marker

What is the mechanistic role of UGT8 in breast cancer metastasis?

UGT8 appears to promote breast cancer progression through specific molecular mechanisms:

  • Cell phenotype correlation:

    • "Luminal epithelial-like" breast cancer cell lines express low levels of UGT8

    • "Mesenchymal-like" malignant cells that form metastases in nude mice express high levels of UGT8

    • This pattern suggests UGT8 may be involved in epithelial-to-mesenchymal transition (EMT), a critical process in metastasis

  • Pathway activation:

    • UGT8 promotes basal-like breast cancer progression through activating the sulfatide–αVβ5 axis

    • The enzyme participates in the sulfatide biosynthetic pathway, affecting downstream metabolites with roles in cancer progression

  • Transcriptional regulation:

    • The UGT8 gene is activated by transcription factors such as Sox10

    • Specific regions of the UGT8 promoter (between −2,211 and −1,507 bp and between −1,050 bp and −274 bp) are important for Sox10-mediated UGT8 activation

    • Understanding this regulation provides potential targets for intervention

  • Functional consequences of manipulation:

    • Knockdown of UGT8 in metastatic breast cancer cell lines (MDA-MB231 and SUM159) reduces production of GalCer and sulfatide

    • Inhibition of UGT8 suppresses basal-like breast cancer progression

How can UGT8 be targeted for therapeutic intervention?

Research into UGT8 inhibition has revealed potential therapeutic strategies:

  • Direct enzyme inhibition:

    • ZA (compound not fully described in the search results) has been identified as a direct inhibitor of UGT8

    • This inhibitor suppresses UGT8-mediated processes and may have therapeutic potential

  • Gene expression modulation:

    • Targeting the transcriptional regulation of UGT8, particularly through Sox10-mediated pathways

    • Mutational analysis of UGT8 promoter binding motifs has identified critical regions for transcriptional activation

  • Pathway intervention:

    • Targeting the sulfatide biosynthetic pathway at multiple points

    • Focusing on the sulfatide–αVβ5 axis activated by UGT8 in cancer progression

  • Rational drug design opportunities:

    • Structure-function studies, including identification of His358 within the UGT signature sequence as important for activity, provide targets for rational inhibitor design

    • Developing specific inhibitors that affect MGDG synthesis without disrupting other UGT8 functions might offer selective therapeutic approaches

What is the role of UGT8 in membrane lipid organization and cellular stress responses?

UGT8 plays a critical role in membrane lipid organization and stress response pathways:

  • Regulation of membrane lipid saturation:

    • UGT8-derived MGDG influences membrane lipid saturation signals

    • UGT8 knockout impairs activation of the unfolded protein response (UPR) induced by membrane lipid saturation

  • ER stress response mechanisms:

    • UGT8 regulates the membrane lipid saturation-induced UPR

    • In UGT8 knockout cells, membrane lipid saturation-induced UPR is suppressed, as determined by reduced PERK phosphorylation and downstream CHOP mRNA induction

    • This suggests UGT8-derived MGDG may be involved in the activation of PERK under membrane lipid saturation

  • Target specificity:

    • MGDG produced by UGT8 may specifically target the transmembrane domain of PERK to activate UPR signals

    • This interaction is significant because PERK uses its transmembrane domain to sense membrane lipid saturation

  • Compartmentalization:

    • Although MGDG content is relatively low compared to phospholipids (<0.1% of the amount of PC), it is enriched in microsomal compartments compared to HexCer

    • This compartmentalization may explain how limited amounts of MGDG can have significant effects on specific cellular processes

How does UGT8 substrate specificity influence its biological functions?

UGT8 demonstrates interesting substrate preferences that impact its biological roles:

What unexpected biological functions has UGT8 been associated with?

Beyond its canonical roles in lipid metabolism and cancer, UGT8 has been linked to surprising biological functions:

  • Genetic association with musical ability:

    • Genomic analyses have associated UGT8 variants with musical ability

    • A significant linkage was found at chromosome 4q23 with the nearest marker D4S2986 (LOD=3.1)

    • An intergenic SNP (rs1251078, p = 8.4 × 10^-17) near UGT8 was highly associated with musical ability

    • A non-synonymous SNP in UGT8 (rs4148254, p = 8.0 × 10^-17) showed strong association with musical ability

    • A 6.2 kb copy number loss near UGT8 showed a plausible association with musical ability (p = 2.9 × 10^-6)

  • Neurological implications:

    • UGT8 is highly expressed in the central nervous system and known to act in brain organization

    • This expression pattern may explain the unexpected association with complex cognitive traits like musical ability

    • The enzyme's role in producing galactolipids may influence neuronal membrane composition and function

  • Developmental processes:

    • The involvement of UGT8 in complex traits suggests potential roles in developmental processes

    • Further investigation of UGT8 function during development could reveal additional biological roles

What are common challenges in UGT8 expression systems and how can they be addressed?

Researchers working with recombinant UGT8 may encounter several challenges:

  • Protein expression detection issues:

    • N-terminal processing of UGT8 can lead to tag cleavage and false negative detection results

    • Solution: Use C-terminal tagged constructs (e.g., mUgt8-FLAG rather than FLAG-mUgt8) to ensure detection of the expressed protein

    • Both mouse and human UGT8 appear to be cleaved between the 20th and 21st amino acid residues

  • Activity verification:

    • Challenge: Confirming that expressed UGT8 is enzymatically active

    • Solution: Monitor both MGDG/ether-MGDG and HexCer production through lipidomic analysis

    • Overexpression of both mouse and human UGT8 should yield comparable increases in these products

  • Species differences consideration:

    • Mouse and human UGT8 have similar enzymatic activities but may have subtle differences

    • When planning cross-species studies, consider using the species-appropriate UGT8 construct

What methodological considerations are important for UGT8 functional analysis?

When designing experiments to analyze UGT8 function, consider these methodological aspects:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.