Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 4 (Hsd3b4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
Hsd3b4; NADPH-dependent 3-keto-steroid reductase Hsd3b4; 3 beta-hydroxysteroid dehydrogenase type 4; 3 beta-hydroxysteroid dehydrogenase type IV; 3 beta-HSD IV; Dihydrotestosterone 3-ketoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Hsd3b4
Target Protein Sequence
PGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKQEEELSKLQTKTKVTVLKG DILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEANVPTFI YSSSVLVAGPNSYKEIILNAHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTLH TCALRLSFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQ DPKKSPSIQGQFYYITDDTPHQSYDDLKCTLSKEWGLRLDTSWSLPLPLLYWLAFLLETV SFLLRPVYNYRPPFNRLLITVLNSVFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV MQHREIGNKKSQ
Uniprot No.

Target Background

Function

Recombinant Mouse 3β-hydroxysteroid dehydrogenase type 4 (HSD3B4) reduces the oxo group at the C-3 position of 5α-androstane steroids. It catalyzes the conversion of dihydrotestosterone to its inactive form, 5α-androstanediol, which does not bind to the androgen receptor (AR). It does not function as an isomerase.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Kidney (at protein level); found only in the cortex, appears to be associated with the proximal tubules; and a minor expression in testis.

Q&A

What is the function of mouse Hsd3b4 in steroid hormone biosynthesis?

Mouse Hsd3b4 is a member of the 3β-hydroxysteroid dehydrogenase/isomerase family that catalyzes both 3β-hydroxysteroid dehydrogenation and Δ5- to Δ4-isomerisation of Δ5-steroid precursors. This enzyme requires NAD(P)+ as a co-factor for these reactions and works alongside CYP11A1, a rate-limiting enzyme in steroidogenesis . Together, these enzymes are essential for producing all classes of steroid hormones by converting various precursors to active hormones and their intermediates.

Similar to other 3β-HSD enzymes, Hsd3b4 likely catalyzes the conversion of pregnenolone (P5) to progesterone (P4), 17α-hydroxypregnenolone (17-OHP5) to 17α-hydroxyprogesterone (17-OHP4), and dehydroepiandrosterone (DHEA) to androstenedione (A4) . These reactions represent critical steps in the biosynthetic pathways leading to mineralocorticoids, glucocorticoids, androgens, and estrogens.

How does mouse Hsd3b4 differ from other 3β-HSD isoforms?

Mouse Hsd3b4 is one of multiple 3β-HSD isoforms in mice, each characterized by tissue-specific expression patterns and potentially different substrate preferences or kinetic properties. While the core catalytic function remains conserved across isoforms, differences in amino acid sequences may influence substrate specificity, cofactor binding affinity, and regulatory mechanisms.

Studies of human 3β-HSD isoforms demonstrate functional differences between types, with type 1 predominantly expressed in placenta and breast tissue, while type 2 is primarily found in gonads and adrenals . Similar tissue-specific distributions may exist among mouse isoforms, with Hsd3b4 potentially having a distinct expression profile and functional characteristics compared to other mouse 3β-HSD proteins.

What are the typical expression patterns of Hsd3b4 in mouse tissues?

Based on knowledge of 3β-HSD isoforms across species, mouse Hsd3b4 is likely expressed in steroidogenic tissues. In other species, 3β-HSD enzymes have been identified in gonads (testis, ovary), adrenal glands, and other steroidogenic tissues . For instance, in rainbow trout, immunohistochemical studies located 3β-HSD in Leydig cells of testes, ovarian follicles, and interrenal cells in the head kidney .

To precisely determine Hsd3b4 expression patterns, researchers should employ techniques such as:

  • RT-PCR or Northern blot analysis for mRNA detection

  • Immunohistochemistry using specific antibodies for protein localization

  • In situ hybridization for tissue-specific mRNA visualization

  • Western blotting of tissue homogenates for protein expression levels

What substrates does mouse Hsd3b4 act upon, and what are its products?

Mouse Hsd3b4, like other 3β-HSD enzymes, likely catalyzes multiple reactions in the steroidogenic pathway, including:

SubstrateProductPathway
Pregnenolone (P5)Progesterone (P4)Progestagen/mineralocorticoid/glucocorticoid
17α-hydroxypregnenolone (17-OHP5)17α-hydroxyprogesterone (17-OHP4)Glucocorticoid
Dehydroepiandrosterone (DHEA)Androstenedione (A4)Androgen/estrogen
AndrostenediolTestosteroneAndrogen

The reaction involves both dehydrogenation of the 3β-hydroxyl group and isomerization of the Δ5 double bond to the Δ4 position . Substrate preference and reaction kinetics should be determined experimentally, as these may differ from other 3β-HSD isoforms.

What are the optimal conditions for expressing recombinant mouse Hsd3b4?

Successful expression of recombinant mouse Hsd3b4 requires careful optimization of several parameters:

Expression Systems:

  • Mammalian cell systems: HEK293 or COS-1 cells provide proper folding and post-translational modifications. In studies with other 3β-HSD isoforms, COS-1 cells have been successfully used .

  • Bacterial systems: E. coli offers high yield but may require refolding due to inclusion body formation.

  • Cell-free systems: Rabbit reticulocyte lysate systems have been used for 3β-HSD expression in short-term studies .

  • Insect cell systems: Baculovirus systems provide good yield with eukaryotic processing.

Vector Design Considerations:

  • Include a strong promoter (CMV for mammalian cells)

  • Consider adding a purification tag that doesn't interfere with enzyme activity

  • Include proper Kozak sequence for optimal translation initiation

  • Consider codon optimization for the expression host

Optimal Culture Conditions:

  • Temperature: 30-37°C (lower temperatures may improve folding)

  • Induction time: Optimize to balance expression and proper folding

  • Media supplements: Consider adding enzyme cofactors or precursors

How can enzyme kinetics of mouse Hsd3b4 be accurately measured?

Accurate measurement of mouse Hsd3b4 enzyme kinetics requires careful experimental design:

Assay Methods:

  • Spectrophotometric assays: Measure NAD(P)H production at 340 nm

  • Reporter-based assays: Use steroid receptor-mediated reporter systems that detect enzyme products

  • Chromatographic methods: HPLC or LC-MS/MS for direct product quantification

  • Radiometric assays: Use radiolabeled substrates and measure conversion

Experimental Design for Kinetic Analysis:

  • Determine linear range for enzyme concentration and reaction time

  • Use appropriate substrate concentration range (typically 0.2-5× Km)

  • Maintain excess cofactor (NAD+ or NADP+) to prevent rate limitation

  • Control temperature and pH precisely

Data Analysis:

  • Fit initial velocity data to appropriate enzyme kinetic models

  • Calculate key parameters (Km, Vmax, kcat, kcat/Km)

  • Compare parameters across different substrates to assess preference

Reporter-based assays can be particularly useful, as demonstrated for human HSD3B2, where product formation was detected through progesterone receptor or androgen receptor activation .

What structural elements are critical for mouse Hsd3b4 function?

Based on structural studies of related 3β-HSD enzymes, several key elements are likely critical for mouse Hsd3b4 function:

Key Structural Elements:

  • Rossmann-fold domain: Critical for NAD(P)+ binding, containing the characteristic nucleotide-binding motif

  • Catalytic residues: Conserved amino acids involved in the dehydrogenation and isomerization reactions

  • Substrate binding pocket: Determines substrate specificity and orientation

  • Cysteine residues: May form functionally important disulfide bonds, as demonstrated in human 3β-HSD1 where an intrasubunit disulfide bond between Cys72 and Cys111 significantly affects enzyme function

  • Membrane-spanning domains: May be involved in subcellular localization and substrate access

Research with human 3β-HSD1 has shown that cysteine residues can form functionally important disulfide bonds that affect enzyme kinetics. For example, β-mercaptoethanol (BME) treatment dramatically decreased Km values for substrates and cofactors by disrupting a disulfide bond between Cys72 and Cys111 . Similar structural features might exist in mouse Hsd3b4.

How do mutations in key residues affect substrate specificity of mouse Hsd3b4?

Mutations in key residues can have diverse effects on substrate specificity, often with substrate-dependent outcomes:

Expected Effects of Mutations:

Studies with human HSD3B2 revealed that different mutations can affect enzymatic activities differently depending on the substrate. For example, some mutations (C72R, S124G, V225D) reduced activity with both P5 and DHEA substrates, while others (V299I) showed substrate-selective effects, maintaining significant activity with P5 but showing reduced activity with DHEA . This substrate-dependent effect correlated with clinical phenotypes in patients.

To investigate such effects in mouse Hsd3b4:

  • Generate site-directed mutants of conserved or predicted functional residues

  • Test activity with multiple physiological substrates

  • Compare kinetic parameters across substrates for each mutant

  • Correlate structural changes with functional consequences

What expression systems are most effective for producing recombinant mouse Hsd3b4?

Each expression system offers distinct advantages for producing recombinant mouse Hsd3b4:

Mammalian Expression Systems:

  • Advantages: Proper folding, post-translational modifications, appropriate cellular environment

  • Cell lines: HEK293, COS-1 (successfully used for rainbow trout 3β-HSD)

  • Considerations: Transfection efficiency, expression level, stable vs. transient

  • Yield improvement: Optimize codon usage, use strong promoters, consider serum-free adapted cells

Bacterial Expression Systems:

  • Advantages: High yield, economical, rapid expression

  • Considerations: May form inclusion bodies requiring refolding, lacks eukaryotic modifications

  • Optimization strategies: Lower induction temperature, use specialized strains (Rosetta, BL21), co-express chaperones

Cell-Free Expression Systems:

  • Advantages: Rapid, allows incorporation of modified amino acids

  • Example: Rabbit reticulocyte lysate system has been used for 3β-HSD expression

  • Best applications: Initial characterization, small-scale studies, testing mutants

Insect Cell Systems:

  • Advantages: Higher yield than mammalian cells, proper folding

  • Considerations: Requires baculovirus generation, specialized equipment

  • Best applications: Large-scale production, complex proteins

For functional studies, mammalian systems generally provide the most native-like enzyme. If structural studies are planned, insect cell or bacterial systems may provide higher yields.

How can antibodies against mouse Hsd3b4 be developed and validated?

Developing specific antibodies against mouse Hsd3b4 requires careful design and validation:

Antigen Design Strategies:

  • Synthetic peptides: Target unique regions of Hsd3b4 sequence not conserved in other isoforms. This approach was successful for rainbow trout 3β-HSD where antibodies were raised against middle and C-terminal oligopeptides .

  • Recombinant protein: Use purified full-length or domain-specific recombinant Hsd3b4.

  • Genetic immunization: DNA vaccination with Hsd3b4-encoding plasmids.

Production Methods:

  • Polyclonal antibodies: Immunize rabbits or other species with selected antigens

  • Monoclonal antibodies: Mouse hybridoma technology or recombinant antibody approaches

Validation Protocol:

  • Western blot analysis: Test against recombinant protein and tissue extracts

  • Immunohistochemistry: Perform on tissues known to express 3β-HSD (e.g., gonads, adrenals)

  • Specificity testing: Cross-reactivity against other mouse 3β-HSD isoforms

  • Knockout/knockdown controls: Test antibody on tissues/cells with reduced target expression

  • Pre-absorption controls: Pre-incubate antibody with immunizing antigen

When developing antibodies against rainbow trout 3β-HSD, researchers validated them by demonstrating recognition of recombinant 3β-HSD in both rabbit reticulocyte lysate and COS-1 cell expression systems, followed by confirmation of specific staining in steroidogenic tissues .

What cell-based assays can be used to evaluate mouse Hsd3b4 activity?

Several cell-based assays can effectively evaluate mouse Hsd3b4 enzymatic activity:

Reporter Gene Assays:
This approach leverages the biological activity of steroid hormone products to measure enzyme activity:

  • Transfect cells (e.g., HEK293) with Hsd3b4 expression vector

  • Add substrate (P5 or DHEA) to the culture medium

  • Collect media containing converted steroids after incubation

  • Transfer media to reporter cells expressing steroid receptors (PR for P4, AR for androgens) and a reporter construct

  • Measure reporter activity as a proxy for enzyme activity

This method was successfully employed for human HSD3B2, where converting P5 to P4 activated progesterone receptor-mediated transcription, and converting DHEA to A4 activated androgen receptor-mediated transcription .

Direct Measurement Assays:

  • LC-MS/MS analysis: Direct quantification of substrate conversion to products

  • Radiometric assays: Using radiolabeled substrates and measuring product formation

  • ELISA-based detection: Using antibodies specific to the product steroids

Experimental Design Considerations:

  • Include appropriate controls (vector-only transfected cells showed no conversion)

  • Optimize substrate concentration and incubation time

  • Consider the kinetics of reporter activation when designing time points

  • Validate with known 3β-HSD inhibitors

How can researchers address issues with low activity of recombinant mouse Hsd3b4?

Low activity of recombinant mouse Hsd3b4 may stem from various factors, each requiring specific troubleshooting approaches:

Protein Expression and Folding:

  • Problem: Improper folding or low expression

  • Solutions:

    • Try different expression systems (mammalian vs. bacterial)

    • Optimize codon usage for expression host

    • Lower expression temperature (30-33°C for mammalian cells)

    • Add chemical chaperones to culture media

Cofactor-Related Issues:

  • Problem: Insufficient or inappropriate cofactor

  • Solutions:

    • Ensure sufficient NAD(P)+ concentration

    • Test both NAD+ and NADP+ as possible cofactors

    • Consider adding reducing agents like β-mercaptoethanol, which can dramatically affect enzyme activity by influencing disulfide bonds

Enzyme Stability:

  • Problem: Enzyme degradation or denaturation

  • Solutions:

    • Add stabilizing agents (glycerol, BSA) to buffers

    • Minimize freeze-thaw cycles

    • Optimize buffer composition (pH, salt concentration)

    • Consider the role of disulfide bonds in stability and activity

Assay Sensitivity:

  • Problem: Activity below detection threshold

  • Solutions:

    • Use more sensitive detection methods (radiometric, LC-MS/MS)

    • Increase enzyme concentration or incubation time

    • Use reporter-based systems that amplify signal

Human 3β-HSD1 research demonstrated that the presence of reducing agents like β-mercaptoethanol can dramatically decrease Km values for substrates and cofactor, suggesting that disulfide bonds play a critical role in enzyme function . Similar considerations may apply to mouse Hsd3b4.

What controls are essential when measuring mouse Hsd3b4 activity?

Robust experimental design requires several key controls when measuring Hsd3b4 activity:

Positive Controls:

  • Wild-type enzyme with known activity

  • Other characterized 3β-HSD isoforms

  • Tissue extracts with endogenous 3β-HSD activity

Negative Controls:

  • Empty vector-transfected cells (research with human HSD3B2 demonstrated no conversion with GFP-transfected control cells)

  • Heat-inactivated enzyme preparations

  • Reaction mixture without enzyme

Substrate Controls:

  • Substrate stability under assay conditions

  • Direct addition of products (P4, A4) to establish standard curves

  • Vehicle-only treatments

Specificity Controls:

  • Known 3β-HSD inhibitors (e.g., trilostane)

  • Mutant enzyme with impaired activity

  • Alternative substrates to assess specificity

Technical Controls:

  • Time-dependence of product formation (linearity)

  • Enzyme concentration dependence

  • Inter-assay and intra-assay calibration standards

In research with human HSD3B2, media from GFP-transfected cells failed to induce reporter activity, while media from HSD3B2-transfected cells produced strong signals in both progesterone and androgen receptor-based reporter systems .

How should discrepancies in Hsd3b4 activity between in vitro and in vivo settings be interpreted?

Discrepancies between in vitro and in vivo Hsd3b4 activity require careful interpretation:

Potential Causes of Discrepancies:

  • Microenvironment Differences:

    • Subcellular localization affects substrate access

    • Membrane association may influence activity

    • Redox environment differences (affecting disulfide bonds)

    • Cofactor availability varies between systems

  • Regulatory Mechanisms:

    • Post-translational modifications present in vivo

    • Protein-protein interactions modulating activity

    • Substrate or product availability regulated in vivo

    • Feedback mechanisms operating in intact cells

  • Methodological Considerations:

    • Different detection sensitivities between methods

    • Substrate solubility or delivery differences

    • Time-dependent effects more pronounced in vivo

  • Data Interpretation Framework:

    • Consider physiological relevance of each system

    • Determine which conditions better reflect true biological function

    • Identify potential regulatory mechanisms explaining differences

    • Assess whether discrepancies reveal novel biological insights

Research with human 3β-HSD1 showed that disulfide bond status significantly affects enzyme kinetics, which might differ between in vitro and cellular environments due to varying redox conditions . Similarly, different mutations in human HSD3B2 affected activity toward different substrates to varying degrees, which could manifest differently depending on substrate availability in various systems .

What are the emerging techniques for studying mouse Hsd3b4 function?

Several cutting-edge approaches are enhancing the study of steroidogenic enzymes like mouse Hsd3b4:

Advanced Structural Biology Approaches:

  • Cryo-electron microscopy for near-native structure determination

  • Computational modeling and molecular dynamics simulations

  • Hydrogen-deuterium exchange mass spectrometry to study protein dynamics

  • Structure-based drug design targeting specific 3β-HSD isoforms

Novel Functional Assays:

  • Reporter-based cellular assays that detect enzyme products through nuclear receptor activation

  • Multiplex steroid profiling using advanced mass spectrometry

  • Live-cell imaging of steroid metabolism using fluorescent sensors

  • High-throughput screening platforms for inhibitor discovery

Systems Biology Approaches:

  • Integration of genomics, transcriptomics, and metabolomics data

  • Network analysis of steroidogenic pathways

  • Mathematical modeling of steroid hormone production dynamics

  • Multi-omics approaches to understand enzyme regulation

The reporter-based assay system described for human HSD3B2 represents an innovative approach that could be adapted for mouse Hsd3b4, allowing rapid assessment of enzyme activity by measuring steroid receptor activation by enzyme products .

How can CRISPR/Cas9 be used to study mouse Hsd3b4 in vivo?

CRISPR/Cas9 technology provides powerful approaches for studying mouse Hsd3b4 function:

Knockout and Knockin Strategies:

  • Complete gene knockout to assess physiological requirements

  • Conditional knockout using loxP-flanked (floxed) alleles for tissue-specific deletion

  • Knockin of reporter genes (GFP, luciferase) to track expression

  • Introduction of specific mutations to model structure-function relationships

Experimental Design Considerations:

  • Design multiple gRNAs targeting Hsd3b4-specific regions

  • Use appropriate Cas9 delivery methods (viral vectors, ribonucleoprotein complexes)

  • Include appropriate controls (non-targeting gRNAs, heterozygous animals)

  • Validate edits by sequencing and expression analysis

Phenotypic Analysis Approaches:

  • Steroid profiling by mass spectrometry to assess enzymatic defects

  • Reproductive and developmental phenotyping

  • Tissue-specific functional assessment

  • Compensatory mechanism identification

Advanced Applications:

  • CRISPRa/CRISPRi for transcriptional modulation without sequence alteration

  • Base editing for precise nucleotide changes

  • Prime editing for targeted insertions or deletions

  • Saturation mutagenesis to comprehensively analyze structure-function relationships

What are the prospects for using mouse Hsd3b4 studies to understand human steroid metabolism disorders?

Mouse Hsd3b4 research offers valuable insights for human steroid metabolism disorders:

Translational Opportunities:

  • Disease Modeling: Creating mouse models with mutations corresponding to human 3β-HSD deficiency can reveal pathophysiological mechanisms.

  • Therapeutic Development: Identifying compensatory pathways or regulatory mechanisms that could be therapeutic targets.

  • Biomarker Discovery: Defining steroid profiles associated with enzyme dysfunction.

  • Mechanistic Insights: Understanding substrate-specific effects of mutations, as demonstrated with human HSD3B2 where different mutations affected different steroid pathways to varying degrees .

Research Approaches with Translational Impact:

  • Comparative analysis of mouse and human 3β-HSD isoforms

  • Humanized mouse models expressing human 3β-HSD variants

  • Preclinical testing of potential therapeutic compounds

  • Investigation of tissue-specific effects of 3β-HSD dysfunction

Limitations and Considerations:

  • Species differences in 3β-HSD isoform number and distribution

  • Different physiological roles of specific steroids between species

  • Variations in regulatory mechanisms and metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.