Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 5 (Hsd3b5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Hsd3b5; NADPH-dependent 3-keto-steroid reductase Hsd3b5; 3 beta-hydroxysteroid dehydrogenase type 5; 3 beta-hydroxysteroid dehydrogenase type V; 3 beta-HSD V; Dihydrotestosterone 3-ketoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Hsd3b5
Target Protein Sequence
PGWSCLVTGAGGFLGQRIVRMLVQEEELQEIRALFRTFGRKHEEELSKLQTKAKVRVLKG DILDAQCLKRACQGMSAVIHTAAAIDPLGAASRQTILDVNLKGTQLLLDACVEASVPTFI YSSSVLVAGPNSYKEIILNAHEEEHRESTWPNPYPYSKRMAEKAVLATNGRLLKNGGTLH TCALRLPFIYGEECQVTSTTVKTALKNNSIIKKNATFSIANPVYVGNAAWAHILAARSLQ DPKKSPSIQGQFYYISDNTPHQSYDDLNYTLSKEWGLCLDSGWSLPLSLLYWLAFLLETV SFLLRPVYNYRPPFNRLLITVLNSVFTISYKKAQRDLGYQPLVSWEEAKQKTSEWIGTLV KQHRETLHKKSQ
Uniprot No.

Target Background

Function

Recombinant Mouse 3β-hydroxysteroid dehydrogenase type 5 (HSD3B5) catalyzes the reduction of the C-3 oxo group in 5α-androstane steroids. Specifically, it converts dihydrotestosterone to its inactive form, 5α-androstanediol, which does not bind to the androgen receptor (AR). It does not exhibit isomerase activity.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the male liver, starting in late puberty.

Q&A

What is Hsd3b5 and what are its primary functions?

Hsd3b5 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5) is an enzyme primarily involved in steroid hormone metabolism. It belongs to the hydroxysteroid dehydrogenase family and catalyzes the conversion of delta-5-steroids to delta-4-steroids, a critical step in the biosynthesis of various steroid hormones .

The protein demonstrates several biochemical functions including (R)-(-)-1,2,3,4-tetrahydronaphthol dehydrogenase activity, (R)-2-hydroxyglutarate dehydrogenase activity, and steroid dehydrogenase activity. Additionally, it exhibits oxidoreductase activity, acting on the CH-OH group of donors, with NAD or NADP as acceptors .

Which biological pathways involve Hsd3b5?

Hsd3b5 participates in several important metabolic and signaling pathways:

  • Steroid hormone biosynthesis

  • General metabolic pathways

  • Ovarian steroidogenesis

These pathways involve interactions with numerous other proteins as summarized in the table below:

Pathway NameRelated Proteins
Ovarian steroidogenesisSTAR, HSD17B2, BMP15, IGF1R, PRKACB, PTGS2, INSR, ALOX5, CYP2J6, SCARB1
Metabolic pathwaysybaS, RDH12, CS, H2-KE6, GALNT18, ALG6, DBH, ODC1, GALT, CAD
Steroid hormone biosynthesisCYP2C50, CYP2C70, AKR1C3, UGT1AB, CYP3A7, SRD5A2B, SRD5A2, CYP3A7-CYP3AP1, CYP3A65, CYP2B19
Aldosterone synthesis and secretionHSD3B2, MC2R, CREB3L3, ADCY6, DAGLB, PRKD2, CAMK1, PRKACG, PRKACA, NPR1

This integrated network of interactions highlights the complex role of Hsd3b5 in maintaining metabolic homeostasis .

What is the relationship between Hsd3b5 and fatty liver disease?

Research has demonstrated a significant negative correlation between Hsd3b5 expression and hepatic steatosis severity. In mouse models of non-alcoholic fatty liver disease (NAFLD), Hsd3b5 expression is consistently decreased . This negative association (rs = -0.53, P < 0.05) suggests that Hsd3b5 may have a protective role against fat accumulation in the liver .

Studies with Corilagin (Cori), a compound that prevents NAFLD, have shown that Cori treatment rescues the decreased Hsd3b5 expression in high-fat diet (HFD)-fed mice. This restoration of Hsd3b5 expression coincides with improvements in hepatic steatosis, suggesting that Hsd3b5 may be mechanistically involved in the pathophysiology of NAFLD .

How does Hsd3b5 expression change in various metabolic disorders?

Hsd3b5 shows distinct expression patterns across different metabolic disorders:

In hepatic P450 reductase null (HRN) mice, Hsd3b5 expression is significantly decreased compared to control mice. This reduction coincides with altered steroid hormone metabolism, as evidenced by lower serum testosterone and estradiol levels . The decrease in Hsd3b5 expression in these mice suggests its regulation may be linked to cytochrome P450 activity.

In genetic models of hepatic steatosis, Hsd3b5 expression is also decreased and shows a negative association with hepatic fat accumulation. When analyzing the correlation between gene expression and hepatic fat content, Hsd3b5 demonstrates a significant negative association (rs = -0.53, P < 0.05), indicating that lower Hsd3b5 levels correspond with higher hepatic fat content .

These findings collectively suggest that Hsd3b5 downregulation is a common feature across multiple metabolic disorders, particularly those involving liver dysfunction.

What regulatory mechanisms control Hsd3b5 expression in the liver?

The regulation of Hsd3b5 expression appears to be multifaceted:

Cytochrome P450 system: Studies using HRN mice have demonstrated that disruption of the cytochrome P450 system leads to decreased Hsd3b5 expression, suggesting this enzyme system plays a role in regulating Hsd3b5 .

Dietary factors: High-fat diet (HFD) feeding results in decreased hepatic Hsd3b5 expression, indicating dietary lipids may negatively regulate this gene. Conversely, treatment with Corilagin can rescue the HFD-induced reduction in Hsd3b5 expression, suggesting bioactive compounds may counteract dietary effects on Hsd3b5 regulation .

Endogenous factors: Research has shown that endogenous factors influence Hsd3b5 expression, as demonstrated by altered transcript levels in various experimental models. These changes in expression are often accompanied by alterations in steroid hormone levels, suggesting potential feedback mechanisms in Hsd3b5 regulation .

How can recombinant Hsd3b5 be used to study steroid metabolism in vitro?

Recombinant Hsd3b5 provides a valuable tool for studying steroid metabolism in controlled in vitro environments. Researchers can use recombinant Hsd3b5 to:

  • Characterize enzyme kinetics by measuring the conversion rates of various delta-5-steroids to delta-4-steroids under different conditions (pH, temperature, cofactor concentrations).

  • Evaluate potential inhibitors or activators by screening compounds for their ability to modulate Hsd3b5 activity in vitro.

  • Study protein-protein interactions by combining recombinant Hsd3b5 with other purified proteins involved in steroid metabolism pathways.

  • Develop in vitro models of steroid metabolism by reconstituting enzymatic cascades using recombinant proteins including Hsd3b5.

Available recombinant Hsd3b5 proteins include various forms with different tags and from different expression systems as shown in this table:

ProductSourceSpeciesTagProtein Length
Recombinant Rat HSD3B5 ProteinMammalian CellsRatHis-
Recombinant Mouse HSD3B5 ProteinMammalian CellsMouseHis-
Recombinant Rat HSD3B5 ProteinHEK293RatAvi&Fc&His-
Recombinant Mouse HSD3B5 ProteinHEK293MouseAvi&Fc&His-
Recombinant Full Length Rat Hsd3B5 ProteinE.coliRatHisFull Length (2-373)
Recombinant Full Length Mouse Hsd3B5 ProteinE.coliMouseHisFull Length (2-373)

These diverse recombinant proteins enable researchers to select the most appropriate form for their specific experimental requirements .

What are the optimal conditions for detecting Hsd3b5 protein by Western blot?

For optimal Western blot detection of Hsd3b5, researchers should follow these methodological guidelines:

  • Sample preparation: Homogenize tissue (1 g) in 10 ml of PBS buffer (136 mM NaCl, 0.2 g/l KCl, 1.44 g/l Na₂HPO₄, and 0.24 g/l KH₂PO₄, pH 7.4) containing protease inhibitor cocktail at 0-4°C. Centrifuge for 10 minutes at 10,000 g to obtain the postmitochondrial supernatant .

  • Protein determination: Use the Bio-Rad dye binding assay to determine protein concentration in your samples .

  • Electrophoresis: Load approximately 10 μg of protein onto a 12% SDS-polyacrylamide gel and perform electrophoresis at 90V for approximately 150 minutes .

  • Transfer: Transfer proteins to PVDF membranes using a semi-dry transfer system at 1.5 mA/cm² .

  • Antibody incubation: Block membranes with appropriate blocking buffer, then incubate with primary antibodies specific to Hsd3b5 (commercial antibodies are available or can be custom-generated). Use HSC70 as a loading control .

  • Signal detection: Incubate with HRP-conjugated secondary antibodies and detect using ECL detection system. For quantification, expose films for various time periods to ensure signal intensity falls within the linear range .

  • Quantification: Calculate band intensity as volume of pixels per mm² using image analysis software such as Quantity One, and normalize to HSC70 signal .

How can qPCR be optimized for measuring Hsd3b5 mRNA expression?

For accurate quantification of Hsd3b5 mRNA expression by qPCR, follow these optimized protocols:

  • RNA extraction: Extract total RNA from liver tissue using standard methods that ensure high purity and integrity (RIN > 8).

  • cDNA synthesis: Synthesize cDNA using reverse transcriptase and oligo(dT) primers or random hexamers.

  • qPCR reaction setup: For each 12.5 μl reaction, combine 2.5 μl of cDNA, 200 nM of forward and reverse primers specific to Hsd3b5, and 100 nM probe in 1× TaqMan® Master Mix .

  • Cycling conditions: Program the thermocycler for:

    • Initial step: 50°C for 2 min, followed by 95°C for 10 min

    • 40 cycles of: 95°C for 15 sec, then 60°C for 1 min

    • Monitor fluorescence at 518 nm with excitation at 494 nm

  • Reference gene selection: Use GAPDH as an internal standard for normalization, though validation of multiple reference genes is recommended for different experimental conditions .

  • Data analysis: Analyze results using appropriate software (e.g., 7700 system software). Calculate relative expression using the 2^(-ΔΔCt) method .

  • Validation: Confirm specificity of PCR amplifications by agarose gel electrophoresis .

This optimized protocol has been successfully used to measure Hsd3b5 expression changes in various experimental models, including HRN mice and models of hepatic steatosis .

What approaches can be used to study Hsd3b5 function in mouse models?

Several experimental approaches can be employed to study Hsd3b5 function in mouse models:

  • Genetic manipulation:

    • Knockout models: Generate Hsd3b5 knockout mice using CRISPR/Cas9 or traditional gene targeting methods to study the physiological consequences of Hsd3b5 deficiency.

    • Liver-specific knockouts: Use Cre-loxP systems with liver-specific promoters (e.g., Albumin-Cre) to study liver-specific functions of Hsd3b5.

    • Overexpression models: Create transgenic mice overexpressing Hsd3b5 to understand gain-of-function effects.

  • Disease models:

    • High-fat diet (HFD): Feed mice a high-fat diet to induce NAFLD and study changes in Hsd3b5 expression, as demonstrated in studies showing decreased Hsd3b5 in HFD-fed mice .

    • HRN mouse model: Use hepatic P450 reductase null mice to study the relationship between cytochrome P450 function and Hsd3b5 expression .

    • Genetic models of steatosis: Utilize genetic models predisposed to hepatic steatosis to investigate the relationship between Hsd3b5 expression and fat accumulation .

  • Pharmacological interventions:

    • Treatment with compounds like Corilagin that rescue Hsd3b5 expression can provide insights into regulatory mechanisms and therapeutic potential .

    • Administration of steroid hormone precursors can help assess the in vivo enzymatic function of Hsd3b5.

  • Analytical approaches:

    • Microarray analysis to identify differentially expressed genes associated with changes in Hsd3b5 expression .

    • Metabolomics to profile steroid metabolites affected by Hsd3b5 manipulation.

    • Proteomics to identify interacting partners of Hsd3b5 in vivo.

How should researchers interpret changes in Hsd3b5 expression in metabolic disease models?

When interpreting changes in Hsd3b5 expression in metabolic disease models, researchers should consider several key factors:

  • Direction and magnitude of change: Decreased Hsd3b5 expression is consistently observed in models of hepatic steatosis and metabolic dysfunction. The magnitude of this decrease often correlates with disease severity, as evidenced by the negative association (rs = -0.53, P < 0.05) between Hsd3b5 expression and hepatic fat content .

  • Relationship to steroid hormone levels: Changes in Hsd3b5 expression should be interpreted in conjunction with measurements of steroid hormone levels, particularly testosterone and estradiol. In HRN mice, decreased Hsd3b5 expression was accompanied by lower serum testosterone and estradiol levels, suggesting functional consequences of altered Hsd3b5 expression .

  • Context within gene networks: Analyze Hsd3b5 expression changes in the context of other differentially expressed genes, particularly those involved in related pathways. For example, in studies of hepatic steatosis, changes in Hsd3b5 expression occurred alongside alterations in other metabolic genes like Fsp27, Cd36, and Scd1 .

  • Response to interventions: The normalization of Hsd3b5 expression following therapeutic interventions (e.g., Corilagin treatment) provides evidence for its potential role in disease pathogenesis and recovery .

  • Tissue specificity: Hsd3b5 expression changes may be tissue-specific, so researchers should consider the tissue context when interpreting results.

What are the potential pitfalls in analyzing Hsd3b5 enzyme activity data?

Several potential pitfalls can complicate the analysis of Hsd3b5 enzyme activity data:

  • Substrate specificity confusion: Hsd3b5 can act on multiple substrates with varying affinities. Failure to account for this broad substrate specificity may lead to misinterpretation of enzyme activity data. Researchers should carefully select and validate substrates for specific experimental questions.

  • Cofactor considerations: Hsd3b5 activity depends on cofactors like NAD or NADP. Variations in cofactor availability or concentration across experimental conditions can significantly impact enzyme activity measurements, leading to inconsistent results.

  • Overlapping enzyme activities: Other hydroxysteroid dehydrogenases (e.g., Hsd3b1, Hsd3b2, Hsd3b6) may have overlapping substrate specificities with Hsd3b5. Without specific inhibitors or genetic models, it can be challenging to attribute observed activities solely to Hsd3b5.

  • Post-translational modifications: Activity of Hsd3b5 may be regulated by post-translational modifications that are not reflected in expression levels. Researchers should consider potential discrepancies between mRNA expression, protein levels, and enzymatic activity.

  • Assay conditions: Variations in assay conditions (pH, temperature, ionic strength) can significantly affect measured enzyme activities. Standardization and reporting of detailed methodological parameters are essential for reproducibility.

  • In vitro versus in vivo considerations: Enzyme activities measured in vitro may not accurately reflect the in vivo situation due to differences in cellular environments, substrate availability, and regulatory factors.

How can researchers integrate Hsd3b5 expression data with other omics datasets?

Integrating Hsd3b5 expression data with other omics datasets requires sophisticated analytical approaches:

  • Multi-omics data integration:

    • Correlate Hsd3b5 transcriptomic data with proteomic profiles to assess translation efficiency and post-transcriptional regulation.

    • Integrate with metabolomics data to link Hsd3b5 expression changes to alterations in steroid metabolites and related compounds.

    • Combine with genomic data to identify potential genetic variants that influence Hsd3b5 expression or function.

  • Network analysis approaches:

    • Construct protein-protein interaction (PPI) networks to identify direct interactors of Hsd3b5, as demonstrated in studies examining hub proteins involved in Corilagin's effects on NAFLD .

    • Perform pathway enrichment analysis to identify biological processes associated with Hsd3b5 expression changes.

    • Use gene co-expression analysis to identify genes that show similar expression patterns to Hsd3b5 across experimental conditions.

  • Visual analytics:

    • Create integrated visualizations that display relationships between Hsd3b5 expression and other molecular features.

    • Develop heatmaps showing correlations between Hsd3b5 expression and metabolite levels or other gene expressions.

  • Machine learning applications:

    • Apply supervised learning algorithms to identify patterns in multi-omics data that predict Hsd3b5 expression or activity.

    • Use unsupervised learning to cluster samples based on multi-omics profiles including Hsd3b5-related features.

  • Validation strategies:

    • Confirm key relationships identified through integrated analysis using targeted experiments.

    • Apply multiple analytical approaches to ensure robustness of findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.