Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase type 7 (Hsd3b7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid form has a 6-month shelf life at -20°C/-80°C, while lyophilized form has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Hsd3b7; 3 beta-hydroxysteroid dehydrogenase type 7; 3 beta-hydroxysteroid dehydrogenase type VII; 3-beta-HSD VII; 3-beta-hydroxy-Delta(5-C27 steroid oxidoreductase; C(27 3-beta-HSD; Cholest-5-ene-3-beta,7-alpha-diol 3-beta-dehydrogenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-369
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Hsd3b7
Target Protein Sequence
MADSAQVPTLVYLVTGGCGFLGEHIVRMLLEREPRLRELRVFDLHLSSWLEELKAGPVQV TAIQGDVTQAHEVAAAMSGSHVVIHTAGLVDVFGKASPKTIHKVNVQGTQNVIDACVQTG TQYLVYTSSMEVVGPNIKGHPFYRGNEDTPYEAVHSHPYPCSKALAEQLVLEANGRKVNG GLPLVTCALRPTGIYGEGHQVMRDFYYQGLRFGGRLFRAVPASVEHGRVYVGNVAWMHIL VARELEQRAALMGGQVYFCYDKSPYKSYEDFNMEFLSPCGLRLIGAHPLLPYWLLVLLAT LNALLQWLLRPLVLYTPLLNPYTLAMANTTFTVSTNKAQRHFGYKPLFSWEESRTRTIQW VQAMEGSAR
Uniprot No.

Target Background

Function
The 3β-hydroxysteroid dehydrogenase (3β-HSD) enzyme system is crucial for biosynthesis of all steroid hormone classes. HSD3B7 exhibits activity against four 7α-hydroxylated sterols but does not metabolize various C19/C21 steroids. It's involved in bile acid synthesis and plays a key role in lymphoid tissue cell positioning and movement by mediating the degradation of 7α,25-dihydroxycholesterol (7α,25-OHC), a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for numerous lymphoid cells.
Gene References Into Functions
  1. Studies reveal essential roles for CYP7B1, HSD3B7, and CH25H in regulating oxysterol production in lymphoid tissues. PMID: 22999953
  2. HSD3B7 catalyzes two reactions inverting the cholesterol 3β-hydroxyl group to the 3α-hydroxyl group in bile acids. This stereochemical alteration eliminates cholesterol absorption in the gut and enterohepatic circulation feedback regulation. PMID: 17601774
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in liver.

Q&A

What is the primary function of Hsd3b7 in mouse physiology?

Hsd3b7 plays a critical role in bile acid synthesis, specifically catalyzing reactions required for the inversion of the 3β-hydroxyl group of cholesterol to the 3α-hydroxyl of bile acids. This epimerization is essential for the proper functioning of bile acids in the enterohepatic circulation. The enzyme's activity is crucial for maintaining normal cholesterol metabolism and absorption in the intestine. Without this stereochemical modification, bile acids cannot properly facilitate cholesterol absorption and participate in negative feedback regulation of bile acid synthesis .

How does Hsd3b7 differ structurally and functionally from other 3β-hydroxysteroid dehydrogenases?

While all 3β-hydroxysteroid dehydrogenases (3β-HSDs) catalyze the oxidative conversion of delta (5)-ene-3-beta-hydroxy steroids and ketosteroids, Hsd3b7 is specifically involved in bile acid synthesis rather than steroid hormone production. Unlike HSD3B2, which is predominantly expressed in gonadal and adrenal steroidogenic cells for producing active steroid hormones, Hsd3b7 is primarily expressed in the liver and is dedicated to bile acid metabolism. The enzyme is relatively small, with the mouse Hsd3b7 gene spanning only about 2.7 kb and containing six exons .

What phenotypic consequences result from Hsd3b7 deficiency in mice?

Hsd3b7 knockout mice display several significant phenotypic consequences:

  • High neonatal mortality (approximately 90% of newborn mice die)

  • Decreased absorption of dietary cholesterol in surviving adults

  • Disrupted negative feedback regulation of bile acid synthesis mediated by the farnesoid X receptor (FXR)

  • Increased fecal bile acid excretion (approximately 2-fold higher)

  • Elevated fecal neutral sterol excretion (2.8-fold higher)

  • Significantly reduced intestinal cholesterol absorption (less than 9% of normal)

  • Compensatory increases in de novo cholesterol synthesis, particularly in the liver (3.5-fold increase) and small intestine

What are the most effective approaches for generating Hsd3b7 knockout mouse models?

Based on published methodologies, an effective approach for generating Hsd3b7 knockout mice involves complete gene replacement rather than partial deletion. The process involves:

  • Constructing a targeting vector that allows complete replacement of the gene with a cassette encoding neomycin resistance

  • Ensuring the cassette is flanked by LoxP sites and contains a gene specifying Cre recombinase linked to a testis-specific promoter

  • Introducing the targeting vector into embryonic stem (ES) cells, where homologous recombination occurs at high frequency (approximately 40%)

  • Selecting ES cell clones that have undergone successful recombination

  • Generating chimeric animals that transmit the altered Hsd3b7 through the germline

This approach has proven successful, with the cassette excision leaving behind a 34-bp LoxP site in place of Hsd3b7, resulting in complete gene knockout with minimal interference from adjacent genomic regions .

How can Hsd3b7 enzymatic activity be quantitatively measured in experimental settings?

While the search results don't specifically describe methods for measuring Hsd3b7 activity, approaches similar to those used for related 3β-HSDs can be adapted. Based on methodologies for measuring HSD3B2 activity, researchers could:

  • Express recombinant mouse Hsd3b7 in an appropriate cell line (such as HEK293)

  • Incubate these cells with appropriate substrates (likely 7α-hydroxy-cholesterol derivatives)

  • Collect culture media at various time points

  • Analyze the conversion of substrates to products using:

    • LC-MS/MS for direct quantification of metabolites

    • Reporter-based assays using nuclear receptor activation (similar to the progesterone/androgen receptor system used for HSD3B2)

The effectiveness of such assays would depend on identifying the appropriate substrates, incubation conditions, and detection methods specific to Hsd3b7's role in bile acid synthesis .

What are the recommended protocols for validating Hsd3b7 knockout models?

Validation of Hsd3b7 knockout models should include multiple complementary approaches:

  • Genotyping: PCR-based confirmation of gene deletion

  • mRNA analysis: Real-time RT-PCR to confirm absence of Hsd3b7 mRNA

  • Protein analysis: Immunoblotting to verify absence of Hsd3b7 protein (normal protein migrates with an apparent molecular weight of ≈33,000)

  • Functional validation: Biochemical analysis of bile acid composition, particularly focusing on 3β-hydroxylated versus 3α-hydroxylated bile acids

  • Physiological validation: Assessment of cholesterol absorption, fecal bile acid excretion, and cholesterol synthesis rates

  • Mass spectrometry: Analysis of bile acid profiles using negative ion FAB-MS or similar techniques to confirm altered bile acid composition

How does Hsd3b7 deficiency affect signaling pathways in the enterohepatic circulation?

Hsd3b7 deficiency profoundly impacts signaling pathways in the enterohepatic circulation, particularly those involving the farnesoid X receptor (FXR):

  • Disruption of negative feedback regulation: In Hsd3b7 knockout mice, the negative feedback regulation of bile acid synthesis mediated by FXR is disrupted.

  • Altered gene expression profiles: mRNA levels of cholesterol 7α-hydroxylase and sterol 12α-hydroxylase, which are normally repressed by bile acids acting through FXR, are elevated approximately 4-fold compared to wild-type mice.

  • Changes in constitutively expressed genes: Steroid 5β-reductase and racemase mRNA levels are increased approximately 3-fold in knockout mice, despite normally being constitutively expressed.

  • Decreased SHP expression: Small heterodimer partner (SHP) mRNA levels, normally induced by FXR and bile acids, are decreased approximately 2-fold.

These findings suggest that the 3α-hydroxyl configuration is critical for bile acids to function as signaling molecules in the FXR pathway, affecting multiple downstream targets involved in bile acid homeostasis .

What is the relationship between Hsd3b7 genetic variants and neurological disorders?

Emerging research suggests a potential link between Hsd3b7 genetic variants and neurological disorders, particularly Parkinson's disease (PD):

  • The HSD3B7 rs9938550 gene variant has been associated with a decreased risk for Parkinson's disease in Caucasian populations.

  • This protective effect has also been observed in Chinese Han populations, specifically reducing the risk of late-onset Parkinson's disease (LOPD).

  • The variant appears to induce a more benign clinical presentation in affected individuals.

  • The mechanism likely involves bile acid biosynthesis, suggesting a previously unrecognized connection between bile acid metabolism and neurodegeneration.

This association highlights the potential broader implications of Hsd3b7 function beyond bile acid metabolism, possibly involving neuroprotective mechanisms that warrant further investigation .

How do compensatory mechanisms operate in Hsd3b7-deficient models?

In Hsd3b7 knockout mice, several compensatory mechanisms engage to maintain homeostasis:

  • Increased cholesterol synthesis: A 3.5-fold increase in de novo cholesterol synthesis in the liver and smaller but significant increases in the duodenal and jejunal segments of the small intestine compensate for reduced dietary cholesterol absorption.

  • Tissue-specific responses: While synthesis increases in the liver and proximal intestine, no changes occur in the ileum or spleen, and a modest decrease is observed in the kidney, demonstrating a tissue-specific compensatory response.

  • Alternative bile acid pathways: Unlike human patients with HSD3B7 deficiency who accumulate 3β-hydroxy-Δ5 bile acids in urine, adult knockout mice show no such accumulation, suggesting the presence of a compensatory metabolic pathway that prevents their accumulation.

  • Fatty acid metabolism adaptation: Rates of fatty acid synthesis increase approximately 20% in the livers of knockout mice, representing an additional metabolic adjustment.

These compensatory mechanisms demonstrate the remarkable adaptability of metabolic systems in response to Hsd3b7 deficiency, though they cannot fully prevent the phenotypic consequences in knockout mice .

How should researchers address apparent discrepancies between human and mouse phenotypes in Hsd3b7 deficiency?

When addressing discrepancies between human and mouse phenotypes in Hsd3b7 deficiency, researchers should consider:

  • Species-specific metabolic pathways: Mice may possess alternative bile acid synthesis pathways that humans lack, explaining why adult knockout mice don't accumulate the same 3β-hydroxy-Δ5 bile acids seen in human patients.

  • Age-dependent effects: While 90% of newborn Hsd3b7 knockout mice die, surviving adults show adaptations. Researchers should examine both developmental and adult consequences separately.

  • Analytical approach validation: Ensure that analytical techniques (such as mass spectrometry) are optimized for both species, as different bile acid pools may require different extraction and detection methods.

  • Contextual data interpretation: When comparing FAB-MS spectra between species, consider that mice are obligate taurine conjugators, which affects bile acid profiles.

The table below summarizes key phenotypic differences between human and mouse Hsd3b7 deficiency:

ParameterHuman HSD3B7 DeficiencyMouse Hsd3b7 Knockout
Clinical manifestationNeonatal liver failure90% neonatal mortality
Urinary metabolitesAccumulation of 3β,7α-dihydroxy-5-cholen-24-oic and 3β,7α,12α-trihydroxy-5-cholen-24-oic acidsNo detectable 3β-hydroxylated bile acids in urine
Bile acid conjugationBoth glycine and taurine conjugatesPrimarily taurine conjugates
Compensatory pathwaysLimited evidencePresent in surviving adult mice

These differences highlight the importance of careful cross-species extrapolation when studying Hsd3b7 function .

What statistical approaches are most appropriate for analyzing Hsd3b7 functional data?

For analyzing Hsd3b7 functional data, the following statistical approaches are recommended:

  • For comparing two experimental groups (e.g., wild-type vs. knockout): Student's t-test is appropriate when data is normally distributed.

  • For multiple group comparisons: One-way ANOVA followed by Tukey's multiple comparison test provides robust analysis while controlling for multiple comparisons.

  • Data presentation formats:

    • For consistent trends: Mean ± SEM (Standard Error of Mean)

    • For emphasizing variability: Mean ± SD (Standard Deviation)

  • Statistical significance threshold: p-values less than 0.05 should be considered significant.

  • Software recommendations: R-based statistical packages with graphical interfaces, such as EZR (Easy R), provide accessible yet powerful statistical analysis capabilities.

When analyzing complex datasets involving multiple tissues, time points, or metabolites, multivariate approaches may be necessary to identify patterns and relationships that might not be apparent with univariate statistics .

How can researchers distinguish between direct and indirect effects of Hsd3b7 manipulation in experimental models?

Distinguishing between direct and indirect effects of Hsd3b7 manipulation requires a multi-faceted approach:

  • Temporal analysis: Examine the sequence of biochemical and physiological changes after Hsd3b7 manipulation. Early changes (hours to days) are more likely direct effects, while later changes (days to weeks) may represent compensatory or secondary responses.

  • Tissue-specific manipulations: Use conditional knockout models or tissue-specific expression systems to isolate the effects of Hsd3b7 deficiency in specific organs.

  • Molecular pathway dissection: Employ pharmacological inhibitors or activators of suspected downstream pathways to determine if phenotypes can be rescued or exacerbated independently of Hsd3b7 status.

  • Metabolomic profiling: Comprehensive analysis of bile acid profiles and related metabolites can help trace the direct consequences of altered Hsd3b7 activity versus secondary metabolic adaptations.

  • Cross-reference with other models: Compare findings with other models of bile acid synthesis disruption to identify common versus unique features of Hsd3b7 deficiency.

For example, the observed increases in cholesterol synthesis in the liver and intestine of Hsd3b7 knockout mice are likely indirect effects resulting from impaired cholesterol absorption rather than direct consequences of altered bile acid stereochemistry .

What are the potential implications of Hsd3b7 in neurodegenerative disease research?

The association between HSD3B7 gene variants and reduced risk of Parkinson's disease opens several promising research avenues:

  • Bile acid-based neuroprotection: Investigating how specific bile acid profiles might protect against neurodegeneration, potentially through anti-inflammatory or anti-apoptotic mechanisms.

  • Genetic screening applications: Exploring whether HSD3B7 variants could serve as biomarkers for Parkinson's disease risk assessment.

  • Therapeutic development: Examining whether pharmacological modulation of Hsd3b7 activity or administration of specific 3α-hydroxylated bile acids might provide neuroprotective benefits.

  • Cross-disorder implications: Determining whether similar associations exist for other neurodegenerative conditions such as Alzheimer's disease or amyotrophic lateral sclerosis.

This connection between bile acid metabolism and neurodegeneration represents an underexplored area that could yield novel insights into disease mechanisms and potential therapies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.