Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (Hsd3b1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 (Hsd3b1) is an enzyme that catalyzes the oxidative conversion of hydroxysteroid precursors into ketosteroids, which is a critical step in the production of steroid hormones .

Gene Polymorphisms and Functionality

HSD3B1 has a common single-nucleotide variant where 2 different germline, missense-encoding alleles result in distinct functional activities of the 3β-HSD1 protein .

  • HSD3B1(1245A) is the adrenal-restrictive allele, encoding for a more rapidly degraded enzyme that restricts conversion of DHEA to testosterone and DHT .

  • HSD3B1(1245C) is the adrenal-permissive allele that encodes for a stable enzyme, resistant to ubiquitination and proteosome degradation, resulting in sustained 3β-HSD1 levels and more robust DHEA-sulfate conversion to testosterone and DHT, thereby generating higher downstream exposure of the prostate to potent androgens .

Role in Prostate Cancer

Inheritance of HSD3B1 is associated with prostate cancer outcomes. The adrenal-permissive HSD3B1(1245C) allele is associated with worse outcomes in patients postprostatectomy and postradiotherapy . The presence of the adrenal-permissive HSD3B1(1245C) allele is associated with resistance to ADT, AR signaling agents, and CYP17A1 inhibition . Men who are homozygous for the HSD3B1 adrenal-permissive CC genotype have worse PCSM compared with those with adrenal-restrictive homozygous (AA) or heterozygous (AC) genotypes .

Role in Lipid Abnormalities

Knockdown of HSD3B1 resulted in significantly decreased androgen production and less consumption of DHEA . Transfection of SZ95 sebocytes with HSD3B1 siRNA reduced HSD3B1 protein expression by 60% compared to a scrambled siRNA negative control . Knockdown of HSD3B1 leads to a decrease in the amounts of SMs in human sebocytes and a robust increase in total TAG .

Expression and Regulation

HSD3B1 expression is elevated in the skin of AD patients and can be restored by treatment . IL-4 and IL-13 promote androgen synthesis in human sebocytes through HSD3B1 . After 4 or 16 weeks of Dupilumab treatment, HSD3B1 expression is significantly reduced . The transcription factor STAT6 (signal transducer and activator of transcription 6) is a key response element downstream of the IL-4 receptor (IL-4R) and promotes HSD3B1 expression .

Polymorphisms and Haplotypes

Systematic identification of common polymorphisms and haplotypes in the genes encoding human HSD3B1 and HSD3B2 can help determine the possible relationship of common DNA sequence variation in these two important genes with the pathophysiology of steroid hormone-dependent disease in humans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Hsd3b1; Hsd3b; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I; 3-beta-HSD I; 3-beta-hydroxy-5-ene steroid dehydrogenase; 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxysteroid 3-dehydrogenase; Delta-5-3-ketosteroid isomerase; Dihydrotestosterone oxidoreductase; Steroid Delta-isomerase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Hsd3b1
Target Protein Sequence
AGWSCLVTGAGGFVGQRIIKMLVQEKELQEVRALDKVFRPETKEEFSKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACVQASVPAFI FCSSVDVAGPNSYKKIVLNGHEEQNHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLN TCALRPMYIYGERSPFIFNAIIRALKNKGILCVTGKFSIANPVYVENVAWAHILAARGLR DPKKSTSIQGQFYYISDDTPHQSYDDLNYTLSKEWGLRPNASWSLPLPLLYWLAFLLETV SFLLRPVYRYRPLFNRHLITLSNSTFTFSYKKAQRDLGYEPLVNWEEAKQKTSEWIGTIV EQHREILDTKCQ
Uniprot No.

Target Background

Function

Recombinant Mouse 3β-hydroxysteroid dehydrogenase/Δ5→4-isomerase type 1 (Hsd3b1) is a bifunctional enzyme crucial for steroid hormone biosynthesis. It catalyzes the oxidation and isomerization of 3β-hydroxy-Δ(5)-steroid precursors to 3-oxo-Δ(4)-steroids. Specifically, it converts pregnenolone to progesterone, 17α-hydroxypregnenolone to 17α-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone. Furthermore, it interconverts 3β-hydroxy and 3-oxo-5α-androstane steroids, influencing the bioavailability of active forms. Hsd3b1 converts dihydrotestosterone to its inactive form, 5α-androstanediol (which does not bind to the androgen receptor), and androstanedione to epiandrosterone. NAD+ is the preferred electron donor for 3β-hydroxysteroid dehydrogenase activity, while NADPH is preferred for 3-ketosteroid reductase activity.

Gene References Into Functions
  1. LH induction of 3β-HSD in nonpregnant mouse endometrium. PMID: 22875961
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Steroidogenic tissues (includes testes, ovaries and adrenal glands).

Q&A

What is the primary function of mouse HSD3B1 and how does it differ from human HSD3B1?

Mouse HSD3B1 functions as a bifunctional enzyme that catalyzes both the oxidation of 3beta-hydroxy-Delta(5)-steroid precursors and their isomerization to 3-oxo-Delta(4)-steroids. This dual enzymatic activity is essential for steroid hormone biosynthesis, specifically converting pregnenolone to progesterone, 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone, dehydroepiandrosterone (DHEA) to 4-androstenedione, and androstenediol to testosterone . Additionally, it catalyzes the interconversion between 3beta-hydroxy and 3-oxo-5alpha-androstane steroids, thereby controlling the bioavailability of active steroid forms .

While mouse and human HSD3B1 share core enzymatic functions, they differ in tissue expression patterns and regulatory mechanisms. The mouse enzyme shows higher expression in placenta and skin, whereas human HSD3B1 is predominantly expressed in placenta and mammary tissue. Both versions likely use NAD(+) as the preferred electron donor for 3beta-hydroxy-steroid dehydrogenase activity and NADPH for 3-ketosteroid reductase activity . These species-specific differences must be considered when translating findings between mouse models and human applications.

What cofactors are required for optimal HSD3B1 activity in research applications?

For optimal enzymatic activity in research applications, mouse HSD3B1 requires specific cofactors for its dual enzymatic functions. The 3beta-hydroxysteroid dehydrogenase activity primarily utilizes NAD+ as an electron acceptor, while the 3-ketosteroid reductase activity preferentially employs NADPH as a reducing agent . When designing in vitro assays with recombinant HSD3B1, researchers should optimize cofactor concentrations, typically using 0.5-2 mM NAD+ for dehydrogenase activity studies and 0.1-0.5 mM NADPH when examining reductase function.

The NAD+/NADH ratio in experimental conditions can significantly influence reaction directionality and kinetics. Additionally, commercial preparations of these cofactors may contain impurities that affect experimental outcomes, warranting the use of high-purity reagents. For extended assays, enzymatic recycling systems can be implemented to maintain consistent cofactor availability, preventing this from becoming a rate-limiting factor in the reaction.

How does HSD3B1 contribute to steroid metabolism pathways in mice?

HSD3B1 plays a pivotal role in multiple steroid metabolism pathways in mice. As a bifunctional enzyme, it orchestrates the conversion of various 3beta-hydroxy-Delta(5)-steroid precursors to their corresponding 3-oxo-Delta(4)-steroids . This enzymatic activity is crucial for:

  • Progesterone biosynthesis: Converting pregnenolone to progesterone

  • Androgen production: Transforming DHEA to androstenedione and androstenediol to testosterone

  • Glucocorticoid synthesis: Converting 17alpha-hydroxypregnenolone to 17alpha-hydroxyprogesterone

  • Regulation of androgen bioavailability: Catalyzing the conversion of dihydrotestosterone to its inactive form 5alpha-androstanediol, which does not bind to androgen receptors

Additionally, recent research has uncovered a novel role for HSD3B1 in oxysterol metabolism, particularly in placental tissue, suggesting broader metabolic functions beyond traditional steroid pathways . This multifaceted involvement in steroid metabolism makes HSD3B1 a critical enzyme for reproductive function, stress responses, and metabolic regulation in mice.

What are the most effective expression systems for producing recombinant mouse HSD3B1?

Several expression systems can be utilized for recombinant mouse HSD3B1 production, each with distinct advantages and limitations. For functional studies requiring properly folded and post-translationally modified enzyme, mammalian expression systems are generally preferred despite their lower yields compared to bacterial systems.

The most effective expression protocol typically involves:

  • Cloning the mouse HSD3B1 cDNA into an appropriate mammalian expression vector such as pcDNA4/HisMax-TOPO or pcDNA3

  • Incorporating affinity tags (e.g., His-tag) to facilitate purification

  • Transfecting the construct into mammalian cells, with HEK293 and COS-1 lines showing good expression results

  • Culturing transfected cells for 24-48 hours to allow for protein expression

  • Lysing cells with gentle detergents (e.g., 0.1% NP40) to preserve enzymatic activity

For enhanced purification and detection, researchers commonly use epitope tags that minimally impact enzyme function. When higher yields are needed and post-translational modifications are less critical, insect cell expression systems provide a valuable alternative, balancing protein quality with production scale.

What transfection parameters optimize HSD3B1 expression in mammalian cells?

Optimizing transfection parameters is crucial for achieving high-level expression of functional mouse HSD3B1 in mammalian cells. Key parameters to consider include:

  • DNA quality: High-purity plasmid preparations with concentrations >1.0 mg/ml and A260/A280 ratios ≥1.8 significantly improve transfection efficiency

  • Cell confluence: Optimal cell density at transfection is typically 50-70% confluence for adherent cells like COS-1

  • Transfection reagent selection: JetOPTIMUS and TransFast reagents have demonstrated good results for HSD3B1 expression

  • DNA-to-reagent ratio: For TransFast, a charge ratio of 1:3 (DNA:reagent) is effective; for JetOPTIMUS, 1 μl reagent per 10 ng of DNA is recommended

  • Incubation conditions: After adding the DNA-reagent complex, incubate cells at 37°C with 5% CO2 for 24-48 hours to allow for protein expression

  • Co-transfection markers: Include a reporter gene such as β-galactosidase to normalize for transfection efficiency across experimental conditions

Post-transfection verification can be performed via Western blotting, immunofluorescence with anti-HSD3B1 antibodies, or enzymatic activity assays. Optimizing these parameters ensures consistent expression of functional recombinant mouse HSD3B1 for downstream applications.

What purification strategy yields the highest purity functional HSD3B1?

Purifying recombinant mouse HSD3B1 to high purity while maintaining enzymatic activity requires a strategic multi-step approach. The most effective purification strategy includes:

  • Initial extraction: Lyse cells with mild detergents (0.1% NP40) in the presence of protease inhibitors to preserve enzyme integrity

  • Affinity chromatography: For His-tagged constructs, nickel or cobalt affinity resins provide effective initial purification

  • Ion exchange chromatography: As a secondary step to remove contaminants based on charge differences

  • Size exclusion chromatography: For final polishing and to ensure the enzyme is in its proper oligomeric state

Throughout the purification process, critical factors to maintain activity include:

  • Keeping all steps at 4°C to minimize protein degradation

  • Including stabilizing agents such as glycerol (10-20%) in buffers

  • Maintaining reducing conditions with agents like DTT or β-mercaptoethanol

  • Avoiding freeze-thaw cycles of purified enzyme

Purification success should be verified through SDS-PAGE for purity assessment, Western blotting for identity confirmation, and enzymatic activity assays to ensure function is preserved. This comprehensive approach yields high-purity, functional HSD3B1 suitable for structural and kinetic studies.

What are the most sensitive methods for measuring mouse HSD3B1 enzyme activity?

Several methods with varying sensitivity levels are available for measuring mouse HSD3B1 activity, with LC-MS/MS approaches offering the highest sensitivity for complex biological samples:

  • Spectrophotometric assays: These monitor NAD+/NADH conversion at 340 nm during the dehydrogenase reaction. While convenient for high-throughput screening, they have moderate sensitivity and may be affected by sample turbidity or interfering compounds.

  • Radiometric assays: Using radiolabeled substrates (e.g., [³H]-pregnenolone), these assays can detect product formation through separation techniques like TLC. They offer excellent sensitivity but require special handling due to radioactivity.

  • HPLC-based assays: These directly measure substrate depletion and product formation, providing good sensitivity and specificity. Sample preparation typically involves:

    • Incubating enzyme with substrate and NAD+

    • Stopping the reaction with organic solvent

    • Extracting steroids

    • Analyzing by HPLC with UV detection

  • LC-MS/MS methods: These provide the highest sensitivity and specificity, allowing detection of multiple steroids simultaneously and definitive product identification. They are particularly valuable for complex biological samples and when studying minor metabolic pathways.

For recombinant enzyme characterization, combining these methods provides comprehensive activity profiles and kinetic parameters such as Km, Vmax, and substrate specificity.

How do genetic variants of mouse HSD3B1 affect enzyme function in experimental models?

Genetic variants of mouse HSD3B1 can significantly alter enzyme function across multiple parameters, providing valuable insights into structure-function relationships. Research has shown that specific variants impact:

  • Substrate specificity: Amino acid substitutions in the substrate binding pocket can alter preferences for different steroid substrates

  • Catalytic efficiency: Variants may show different Km and Vmax values for the same substrate

  • Protein stability: Some mutations affect protein folding and half-life

  • Subcellular localization: Variants may show altered distribution between cellular compartments

  • Cofactor utilization: Changes in NAD+ or NADPH binding domains can affect cofactor preference

Research approaches for characterizing variant effects include:

  • Site-directed mutagenesis to create variant expression constructs

  • Side-by-side enzymatic assays comparing wild-type and variant forms

  • Stability studies under various conditions

  • Immunofluorescence to assess subcellular localization

In disease models, HSD3B1 variants show distinct phenotypes. For example, in studies of glucocorticoid responsiveness, the adrenal restrictive HSD3B1(1245A) allele limits conversion from adrenal precursors to potent androgens, while the adrenal permissive HSD3B1(1245C) allele increases this conversion . These genetic differences translate to significant variations in physiological responses to steroid treatments.

What is the subcellular localization of mouse HSD3B1 and how does it impact function?

Mouse HSD3B1 primarily localizes to the endoplasmic reticulum (ER) membrane, which significantly influences its enzymatic function and interaction with other steroidogenic enzymes. Immunofluorescence studies using confocal microscopy show co-localization with ER markers such as calnexin , confirming its membrane association.

This ER localization has several functional implications:

  • Substrate accessibility: The membrane association facilitates access to lipophilic steroid substrates that partition into the ER membrane

  • Metabolic compartmentalization: Positioning within the ER creates microenvironments with optimal conditions for steroid metabolism

  • Enzymatic pathway coordination: Proximity to other steroidogenic enzymes in the ER enables efficient substrate channeling between sequential reactions

  • Regulatory control: ER localization subjects HSD3B1 to unique regulatory mechanisms including calcium signaling and ER stress responses

To study subcellular localization, researchers typically use:

  • Immunofluorescence with antibodies against HSD3B1 and organelle markers

  • Subcellular fractionation followed by Western blotting or activity assays

  • Fluorescent protein fusion constructs for live-cell imaging

Alterations in subcellular localization, whether through mutations, post-translational modifications, or cellular stress conditions, can significantly impact enzyme function and subsequently affect steroid hormone production pathways.

How does the HSD3B1 genotype influence glucocorticoid responsiveness in disease models?

The HSD3B1 genotype significantly impacts glucocorticoid responsiveness in disease models, with important implications for treatment outcomes. Research from the Severe Asthma Research Program (SARP) has revealed a critical association between specific HSD3B1 variants and treatment response .

The key genetic variants involve a missense polymorphism:

  • The adrenal restrictive HSD3B1(1245A) allele limits conversion from adrenal precursors to potent androgens

  • The adrenal permissive HSD3B1(1245C) allele enhances conversion of DHEA to potent androgens

Clinical studies demonstrate striking genotype-dependent differences in treatment outcomes:

  • Patients homozygous for the adrenal restrictive genotype (AA) show significantly worse lung function when treated with glucocorticoids (GC) compared to those not receiving GC treatment (pre-BD-FEV1PP: 54.3% vs. 75.1%, p<0.001)

  • In contrast, patients homozygous for the adrenal permissive genotype (CC) maintain similar lung function regardless of GC treatment (pre-BD-FEV1PP: 73.4% vs. 78.9%, p=0.39)

  • Heterozygous individuals (AC) show intermediate responses, with smaller but still significant differences between GC and non-GC groups

These findings suggest that HSD3B1 genotyping could serve as a valuable biomarker for predicting glucocorticoid treatment response, potentially guiding personalized therapeutic decisions in conditions like asthma.

What role does HSD3B1 play in oxysterol metabolism?

Recent research has uncovered an unexpected role for HSD3B1 in oxysterol metabolism, expanding our understanding of this enzyme beyond traditional steroid hormone pathways. HSD3B1 functions as an oxysterol 3β-hydroxysteroid dehydrogenase, particularly in placental tissue .

This newly identified function has several significant implications:

  • Expanded substrate range: Beyond classical steroids, HSD3B1 can metabolize oxysterols, which are oxidized derivatives of cholesterol with important signaling functions

  • Placental metabolism: HSD3B1 in placenta appears to be the source of unexpected 3-oxo-4-ene oxysterols detected in cord blood and pregnant women's plasma

  • Regulatory functions: Oxysterols act as ligands for nuclear receptors including Liver X Receptors (LXRs) and serve as intermediates in bile acid synthesis

  • Immune modulation: Oxysterol metabolites influence immune cell function and inflammatory responses

Experimental approaches to study this function include:

  • Transfection studies using HSD3B1 expression constructs in cell models

  • LC-MS/MS analysis to detect specific oxysterol metabolites

  • In vitro enzyme assays with purified recombinant HSD3B1 and oxysterol substrates

This expanded role for HSD3B1 suggests it may influence lipid homeostasis, cholesterol metabolism, and inflammatory processes through previously unrecognized pathways, opening new avenues for therapeutic targeting.

What associations exist between HSD3B1 polymorphisms and clinical outcomes?

HSD3B1 polymorphisms show significant associations with various clinical outcomes, particularly in hormone-responsive conditions and treatment responses. These associations provide valuable insights for translational research and potential personalized medicine approaches.

Key clinical associations include:

  • Glucocorticoid treatment response:

    • In asthma patients, the adrenal restrictive HSD3B1(1245A) allele is associated with worse lung function outcomes when treated with glucocorticoids

    • This effect appears to be driven by glucocorticoid suppression of adrenal androgen production, which affects inflammatory responses differently based on genotype

  • Cancer treatment outcomes:

    • Studies in prostate cancer show that HSD3B1 genetic variants are distinctly associated with oncological outcomes between primary androgen deprivation therapy (ADT) and abiraterone treatment

    • The heterozygous and homozygous variant types were significantly associated with higher risk of progression (HR, 2.16; 95% CI, 1.14-3.85; p=0.02) compared with homozygous wild type

    • These findings suggest that HSD3B1 genotyping could help predict treatment response in hormone-dependent cancers

  • Inflammatory disease progression:

    • HSD3B1 variants impact neutrophil counts and inflammatory markers in response to treatment

    • These effects may contribute to disease progression in inflammatory conditions

These associations highlight the potential of HSD3B1 genotyping as a biomarker for predicting treatment outcomes and guiding personalized therapeutic approaches in various clinical contexts.

How can site-directed mutagenesis be utilized to study structure-function relationships in mouse HSD3B1?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in mouse HSD3B1, allowing researchers to systematically probe specific amino acid residues and domains. This technique can elucidate critical aspects of enzyme mechanism, substrate specificity, and regulation.

A comprehensive site-directed mutagenesis strategy typically follows these steps:

  • Rationale-based target selection:

    • Conserved residues across species (suggesting functional importance)

    • Regions implicated in substrate binding or catalysis

    • Naturally occurring variants with phenotypic effects

    • Potential post-translational modification sites

  • Mutagenesis protocol:

    • Use wild-type HSD3B1 cDNA in an expression vector as template

    • Perform circular PCR with primers containing the desired mutation

    • Create single mutations as well as double or triple variants to study combinatorial effects

    • Verify all constructs by sequencing in both directions

  • Functional characterization:

    • Express wild-type and mutant constructs in parallel under identical conditions

    • Compare enzyme kinetics (Km, Vmax, catalytic efficiency)

    • Assess protein stability and expression levels

    • Determine subcellular localization using immunofluorescence

    • Evaluate substrate specificity profiles

This approach has successfully identified key residues involved in cofactor binding, catalytic activity, and protein-protein interactions in HSD3B1, providing critical insights into how genetic variants may influence enzyme function and associated disease phenotypes.

What approaches can be used to study HSD3B1 regulation at the transcriptional level?

Studying HSD3B1 transcriptional regulation requires multiple complementary approaches to uncover the complex mechanisms controlling its expression in different tissues and physiological states:

  • Promoter analysis:

    • Clone approximately 1000 bp of the HSD3B1 5'-flanking region into reporter constructs

    • Create deletion and mutation series to map regulatory elements

    • Perform luciferase reporter assays to quantify promoter activity under different conditions

    • Identify tissue-specific regulatory elements

  • Transcription factor studies:

    • Conduct electrophoretic mobility shift assays (EMSA) to identify protein-DNA interactions

    • Perform chromatin immunoprecipitation (ChIP) to confirm binding of specific factors in vivo

    • Use bioinformatics tools to predict transcription factor binding sites

    • Validate predictions with mutational analysis of binding sites

  • Epigenetic regulation analysis:

    • Assess DNA methylation patterns using bisulfite sequencing

    • Examine histone modifications through ChIP with specific antibodies

    • Map chromatin accessibility using ATAC-seq or DNase-seq

    • Evaluate the effects of epigenetic modifiers on HSD3B1 expression

  • Expression profiling:

    • Quantify HSD3B1 mRNA levels across tissues and developmental stages using qRT-PCR

    • Employ single-cell RNA-seq to identify cell-specific expression patterns

    • Analyze responses to hormones, stress conditions, and signaling pathway activators

These approaches can reveal tissue-specific, developmental, and stress-responsive regulation of HSD3B1, providing insights into both physiological function and potential therapeutic targeting.

How can protein-protein interactions of HSD3B1 be identified and characterized?

Identifying and characterizing protein-protein interactions (PPIs) of HSD3B1 is essential for understanding its integration within broader cellular networks and regulatory mechanisms. Several complementary techniques can be employed:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express epitope-tagged HSD3B1 in relevant cell types

    • Perform immunoprecipitation under native conditions

    • Identify co-precipitating proteins by mass spectrometry

    • Validate top candidates with reciprocal co-immunoprecipitation

  • Proximity labeling approaches:

    • Generate BioID or APEX2 fusion proteins with HSD3B1

    • Express in cells and activate labeling

    • Purify biotinylated proteins and identify by mass spectrometry

    • This approach captures both stable and transient interactions

  • Fluorescence-based interaction assays:

    • Förster Resonance Energy Transfer (FRET) with fluorescent protein fusions

    • Fluorescence Correlation Spectroscopy (FCS) for dynamic interactions

    • Bimolecular Fluorescence Complementation (BiFC) for direct visualization in cells

  • Protein complementation assays:

    • Split-reporter systems (luciferase, β-galactosidase)

    • Yeast or mammalian two-hybrid screening

    • Systematic testing of candidate interactors

  • Structural biology approaches:

    • Co-crystallization with interacting partners

    • Cross-linking coupled with mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry

These methods have revealed interactions between HSD3B1 and other steroidogenic enzymes, chaperones, and regulatory proteins, providing insights into enzyme regulation, subcellular targeting, and pathway coordination within steroid metabolism networks.

What are common challenges in expressing and purifying functional recombinant mouse HSD3B1?

Researchers frequently encounter several challenges when expressing and purifying functional recombinant mouse HSD3B1. Understanding these issues and their solutions is crucial for successful experimental outcomes:

  • Low expression levels:

    • Challenge: HSD3B1 often expresses at lower levels than cytosolic proteins

    • Solution: Optimize codon usage for the expression system, use strong promoters, and consider inducible expression systems to reduce potential toxicity

  • Inclusion body formation (in bacterial systems):

    • Challenge: HSD3B1 may form insoluble aggregates, particularly in E. coli

    • Solution: Express at lower temperatures (16-20°C), use solubility-enhancing fusion tags, or switch to mammalian expression systems

  • Loss of activity during purification:

    • Challenge: The bifunctional nature of HSD3B1 makes it sensitive to purification conditions

    • Solution: Include stabilizing agents (glycerol, reducing agents), maintain constant low temperature, and minimize exposure to proteases by including inhibitor cocktails

  • Membrane association complications:

    • Challenge: HSD3B1's membrane association can complicate extraction and purification

    • Solution: Use mild detergents (0.1% NP-40) for initial extraction, consider detergent screening, and optimize detergent-to-protein ratios

  • Co-factor dependency for stability:

    • Challenge: HSD3B1 may require co-factors for structural integrity

    • Solution: Include NAD+ or NADPH in purification buffers at low concentrations

Addressing these challenges through systematic optimization of expression conditions, careful buffer selection, and appropriate handling procedures significantly improves the yield of functional recombinant mouse HSD3B1 for downstream applications.

How can enzymatic assays for HSD3B1 be optimized for different substrate types?

Optimizing enzymatic assays for HSD3B1 requires tailored approaches for different substrate types, particularly given the enzyme's ability to act on diverse steroid and oxysterol substrates. Key optimization strategies include:

  • For standard steroid substrates (pregnenolone, DHEA):

    • Buffer optimization: Phosphate buffer (50-100 mM, pH 7.4-7.6) works well for most assays

    • Substrate solubilization: Limited water solubility requires careful preparation; use minimal amounts of ethanol or DMSO (<1% final concentration) or cyclodextrins as carriers

    • Reaction monitoring: UV absorbance or HPLC with UV detection is generally sufficient

  • For oxysterol substrates:

    • Higher sensitivity detection: LC-MS/MS is preferred due to lower concentrations and complex matrices

    • Specialized extraction: Modified Folch extraction protocols with internal standards

    • Antioxidant inclusion: BHT or other antioxidants prevent auto-oxidation during processing

  • General optimization considerations:

    • Temperature: 37°C is physiologically relevant, but stability may be better at 30°C

    • Time course: Establish linear range by sampling at multiple timepoints

    • Enzyme concentration: Adjust to obtain measurable activity while remaining in linear range

    • Controls: Include no-enzyme, no-substrate, and known inhibitor controls

  • Data analysis refinements:

    • Substrate depletion correction: Account for decreasing substrate availability in longer incubations

    • Product inhibition assessment: Test for inhibitory effects of reaction products

    • Statistical validation: Multiple replicates and appropriate statistical tests to ensure reproducibility

These optimized approaches ensure reliable, reproducible measurements of HSD3B1 activity across diverse substrate types, facilitating comparative studies of enzyme function.

What controls and validation steps are essential when studying HSD3B1 function?

Robust experimental design for studying HSD3B1 function requires comprehensive controls and validation steps to ensure reliable and reproducible results:

  • Expression controls:

    • Empty vector transfection as negative control

    • Co-transfected reporter gene (β-galactosidase) to normalize for transfection efficiency

    • Quantitative RT-PCR to confirm mRNA expression levels

    • Western blotting with specific antibodies to verify protein expression

  • Enzymatic activity controls:

    • Heat-inactivated enzyme preparations to establish baseline

    • Reactions without cofactors (NAD+/NADPH) to confirm cofactor dependency

    • Known HSD3B1 inhibitors (e.g., trilostane) as pharmacological controls

    • Purified or commercial enzyme standards when available

  • Substrate and product validation:

    • Authentication of substrates and standards by mass spectrometry

    • Multiple detection methods (e.g., HPLC and LC-MS/MS) for critical findings

    • Inclusion of isotopically labeled internal standards for quantitative assays

    • Analysis of all potential metabolites to account for unexpected activities

  • Genetic validation:

    • Multiple siRNA or shRNA constructs targeting different regions of HSD3B1

    • CRISPR/Cas9-mediated knockout as definitive genetic control

    • Rescue experiments with wild-type enzyme to confirm specificity

    • Mutant constructs with known activity alterations as functional controls

  • Statistical validation:

    • Biological replicates (n≥3) from independent experiments

    • Technical replicates to assess methodological variation

    • Appropriate statistical tests with correction for multiple comparisons

    • Power analysis to ensure adequate sample size

These comprehensive controls and validation steps are essential for generating high-quality, reproducible data on HSD3B1 function that can withstand scientific scrutiny and provide a solid foundation for subsequent research.

What emerging technologies could advance our understanding of HSD3B1 function?

Several cutting-edge technologies show significant promise for advancing our understanding of HSD3B1 function across multiple dimensions:

  • CRISPR-based approaches:

    • Base editing for precise introduction of specific HSD3B1 variants without double-strand breaks

    • CRISPRi/CRISPRa for reversible modulation of endogenous HSD3B1 expression

    • CRISPR screens to identify regulators and interactors of HSD3B1

    • Prime editing for modeling complex genetic variants

  • Advanced imaging technologies:

    • Super-resolution microscopy for detailed subcellular localization studies

    • Label-free imaging approaches to study native HSD3B1 without tag interference

    • Live-cell imaging with activity-based probes to monitor HSD3B1 function in real-time

    • Correlative light and electron microscopy to connect function with ultrastructure

  • Systems biology integration:

    • Multi-omics approaches linking HSD3B1 genetic variation to transcriptomic, proteomic, and metabolomic outcomes

    • Mathematical modeling of steroid biosynthesis networks incorporating HSD3B1 kinetics

    • Machine learning applications to predict functional impacts of HSD3B1 variants

  • Structural biology advances:

    • Cryo-EM for determination of HSD3B1 structure in different functional states

    • Hydrogen-deuterium exchange mass spectrometry to map conformational dynamics

    • AlphaFold2 and other AI-based structure prediction tools to model variant effects

  • Organoid and tissue-specific models:

    • Patient-derived organoids to study HSD3B1 function in relevant tissue contexts

    • Microfluidic organ-on-chip systems to examine steroid metabolism in complex tissues

    • Tissue-specific conditional knockout mouse models for precise temporal control

These emerging technologies will enable researchers to address long-standing questions about HSD3B1 function, regulation, and role in disease processes with unprecedented precision and contextual relevance.

What are unexplored aspects of HSD3B1 biology that warrant investigation?

Despite significant advances in understanding HSD3B1, several important aspects of its biology remain unexplored or insufficiently characterized, presenting valuable opportunities for future research:

  • Non-canonical substrates and pathways:

    • The recently discovered role of HSD3B1 in oxysterol metabolism suggests potential activity toward other unidentified substrates

    • Investigation of xenobiotic metabolism by HSD3B1 could reveal new detoxification pathways

    • Potential roles in neurosteroid metabolism and subsequent effects on neurological function

  • Regulatory networks and epigenetic control:

    • Comprehensive mapping of transcription factor networks controlling tissue-specific expression

    • Epigenetic regulation across development and in response to environmental stressors

    • Non-coding RNA regulation of HSD3B1 expression and activity

  • Post-translational modifications and dynamic regulation:

    • Systematic identification of PTMs affecting HSD3B1 function

    • Temporal dynamics of modifications in response to cellular signals

    • Cross-talk between different modifications and their functional consequences

  • Subcellular compartmentalization:

    • Potential dynamic changes in localization under different physiological conditions

    • Impact of membrane composition on enzymatic activity

    • Interaction with organelle-specific proteins and their functional implications

  • Evolutionary aspects and species differences:

    • Comparative analysis across species to identify conserved and divergent features

    • Evolutionary pressures driving HSD3B1 diversification

    • Implications for using mouse models to study human conditions

These unexplored aspects represent fertile ground for new discoveries that could significantly expand our understanding of HSD3B1 biology and potentially reveal novel therapeutic targets for steroid-dependent conditions.

How might targeting HSD3B1 function lead to new therapeutic approaches?

Targeting HSD3B1 function represents a promising avenue for developing novel therapeutic approaches across multiple disease contexts. Based on current understanding, several strategic approaches show particular promise:

  • For glucocorticoid-resistant inflammatory conditions:

    • Development of selective HSD3B1 inhibitors to modulate adrenal androgen metabolism

    • Genotype-guided therapy approaches, with interventions tailored to HSD3B1(1245) status

    • Combination therapies addressing both glucocorticoid signaling and androgen pathways

  • For hormone-dependent cancers:

    • Targeting HSD3B1-dependent androgen synthesis, particularly in treatment-resistant states

    • Stratification of patients based on HSD3B1 genotype to predict treatment response

    • Development of dual-action compounds affecting both HSD3B1 and downstream androgen signaling

  • For metabolic disorders:

    • Modulation of HSD3B1-dependent oxysterol metabolism to influence lipid homeostasis

    • Targeting tissue-specific HSD3B1 activity to achieve localized effects

    • Exploiting HSD3B1 pathway interactions with nuclear receptors regulating metabolism

  • Novel targeting approaches:

    • Allosteric modulators offering greater selectivity than active-site inhibitors

    • Proteolysis-targeting chimeras (PROTACs) for selective HSD3B1 degradation

    • RNA-based therapeutics to modulate HSD3B1 expression in specific tissues

  • Companion diagnostics:

    • Development of HSD3B1 genotyping assays to guide treatment selection

    • Biomarkers of pathway activity to monitor treatment efficacy

    • Imaging approaches to assess target engagement in vivo

These therapeutic strategies leverage our growing understanding of HSD3B1 function and genetic variation to address unmet clinical needs in inflammatory, oncologic, and metabolic conditions, potentially enabling more personalized and effective treatment approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.