Recombinant Mouse 3-beta-hydroxysteroid-Delta (8),Delta (7)-isomerase (Ebp)

Shipped with Ice Packs
In Stock

Description

Enzymatic Role

Ebp catalyzes the isomerization of Δ8-sterols (e.g., zymosterol) to Δ7-sterols (e.g., lathosterol), enabling downstream cholesterol synthesis . This reaction involves a proton-transfer mechanism mediated by residues H76 and E80, stabilized by π-cation interactions with W196 .

Non-Enzymatic Functions

  • Hedgehog Signaling Regulation: Ebp directly binds Smoothened (SMO) to inhibit its cholesterylation, modulating Hedgehog pathway activity .

  • Drug Binding: Ebp interacts with diverse pharmacologically active compounds (e.g., antidepressants, antipsychotics) via a hydrophobic cavity rich in aromatic residues .

Research Applications

Recombinant Ebp is widely used to:

  1. Study cholesterol biosynthesis defects (e.g., Smith-Lemli-Opitz syndrome, CDPX2) .

  2. Investigate Hedgehog signaling dysregulation in cancer .

  3. Screen ligands targeting Ebp for therapeutic development .

Key Research Findings

  • Cancer Relevance: Ebp inhibition induces apoptosis in cancer cells, highlighting its therapeutic potential .

  • Genetic Disorders: CDPX2-linked Ebp mutants retain sterol isomerase activity but impair SMO cholesterylation, suggesting dual pathogenic mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Ebp; Msi; 3-beta-hydroxysteroid-Delta(8,Delta(7-isomerase; Cholestenol Delta-isomerase; Delta(8-Delta(7 sterol isomerase; D8-D7 sterol isomerase; Emopamil-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-230
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Ebp
Target Protein Sequence
TTNTVPLHPYWPRHLKLDNFVPNDLPTSHILVGLFSISGGLIVITWLLSSRASVVPLGAG RRLALCWFAVCTFIHLVIEGWFSLYNGILLEDQAFLSQLWKEYSKGDSRYILSDSFVVCM ETVTACLWGPLSLWVVIAFLRQQPFRFVLQLVVSMGQIYGDVLYFLTELHEGLQHGEIGH PVYFWFYFVFLNAVWLVIPSILVLDAIKHLTSAQSVLDSKVMKIKSKHN
Uniprot No.

Target Background

Function
Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.
Gene References Into Functions
  1. These findings indicate that the HO-1/EBP interaction plays a protective role in alleviating the dysfunction of oxidative stress and cardiac systolic function induced by cholesterol stimulation. PMID: 28487965
  2. Mouse Tdho abnormality results from double point mutations of the emopamil binding protein gene (Ebp). PMID: 11471053
Database Links
Involvement In Disease
Defects in Ebp are a cause of 'Tattered' (Td) which is an X-linked, semidominant mouse mutation associated with prenatal male lethality. Heterozygous females are small and at 4 to 5 days of age develop patches of hyperkeratotic skin where no hair grows, resulting in a striping of the coat in adults. Craniofacial anomalies and twisted toes have also been observed in some affected females.
Protein Families
EBP family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus envelope. Cytoplasmic vesicle.

Q&A

What is EBP and what is its role in cholesterol biosynthesis?

EBP (Emopamil-binding protein) is encoded by the EBP gene and functions as a vertebrate sterol Δ8-Δ7 isomerase. It catalyzes the shift of the double bond from C8-C9 to C7-C8 position, which represents one of the last steps in cholesterol de novo biosynthesis . This isomerization is essential for proper sterol structure formation. EBP was initially characterized through its high binding affinity for emopamil, a calcium channel blocker with anti-ischemic properties . The enzyme is crucial for maintaining cellular cholesterol homeostasis, with mutations in the EBP gene causing X-chromosomal disorders in humans .

How is the EBP gene regulated in different experimental models?

Studies of EBP-like gene in chickens, which shares homology with mammalian EBP, show that estrogen significantly upregulates its expression. When chicken hepatocellular carcinoma cells (LMH) were treated with 17β-estradiol at concentrations of 25, 50, and 100 nM, EBP-like expression showed a significant dose-dependent increase . This estrogen-responsive regulation was confirmed both in vitro in cell culture and in vivo in chicken liver tissue .

In porcine models, steroids have been shown to influence the expression of enzymes involved in sterol metabolism, with different responses based on developmental stages. For instance, estrone sulfate and androstenone produced a significant induction of 3β-HSD (another steroid-metabolizing enzyme) in hepatocytes from heavy-weight pigs but had no effect in low-weight pigs . This suggests developmental and weight-dependent regulation that may also apply to EBP.

What methodologies are most effective for EBP overexpression and knockdown studies?

For overexpression studies, the coding sequence of the target gene can be cloned into expression vectors such as pcDNA3.1-EGFP. Based on the methodology used for chicken EBP-like, researchers successfully constructed overexpression vectors by adding appropriate restriction sites (such as HindIII and BamHI) and the Kozark sequence (GCCACC) to the coding sequence, then cloning it into the pcDNA3.1-EGFP vector . This approach resulted in more than 300-fold increase in expression levels 24 hours post-transfection .

For knockdown studies, siRNA has proven effective. In the chicken EBP-like study, researchers designed and synthesized specific siRNA fragments with FAM fluorescent labels . When transfected into cells, this approach significantly decreased the expression of the target gene, demonstrating effective gene interference .

The evaluation of transfection efficiency can be monitored through fluorescent tags (EGFP for overexpression or FAM labels for siRNA), allowing visualization of successful transfection in living cells .

How does EBP inhibition affect downstream cholesterol biosynthesis pathways?

Inhibition of EBP expression has cascading effects on the cholesterol biosynthetic pathway. In chicken liver cells, knockdown of EBP-like using siRNA resulted in suppression of downstream genes in the cholesterol synthetic pathway, including SC5D, DHCR24, and DHCR7 . This downregulation of downstream enzymes ultimately led to decreased intracellular total cholesterol levels .

These findings suggest that EBP plays a critical regulatory role in the cholesterol biosynthesis pathway, with its inhibition affecting not only its direct catalytic activity but also the expression and function of other enzymes in the pathway. This indicates potential feedback mechanisms or coordinated regulation between these enzymes.

What is the evolutionary conservation of EBP across species?

Evolutionary analysis of EBP shows that this enzyme is relatively conserved across species, reflecting its fundamental role in cholesterol biosynthesis. The chicken EBP-like gene, for example, originated from a common ancestor with Japanese quail EBP gene . Phylogenetic analysis reveals conservation of EBP among different species, though with some variations that may reflect species-specific adaptations in cholesterol metabolism .

The conservation pattern suggests that while the basic enzymatic function is preserved, there may be species-specific regulatory mechanisms or structural adaptations. In birds, for instance, the EBP-like gene serves as a substitute for the EBP gene found in mammals, yet maintains the essential role in cholesterol synthesis .

How does the subcellular localization of sterol isomerases influence their function?

While specific information about EBP subcellular localization is limited in the provided search results, insights can be drawn from related enzymes. For instance, 3β-hydroxysteroid dehydrogenase, another enzyme involved in steroid metabolism, displays dual subcellular localization in both the endoplasmic reticulum (ER) and mitochondria . Within these compartments, histochemical techniques have localized the activity to the smooth ER and mitochondrial cristae .

This dual localization pattern may be significant for accessing different pools of substrates or interacting with different cellular components. For membrane-bound enzymes like EBP, subcellular localization can determine:

  • Access to substrate molecules in different cellular compartments

  • Interactions with other enzymes in the cholesterol biosynthesis pathway

  • Regulation by compartment-specific factors

  • Efficiency of product utilization in different cellular locations

The variable distribution between ER and mitochondria may represent a regulatory mechanism to control the enzyme's activity based on cellular needs .

What are optimal expression systems for producing active recombinant mouse EBP?

For recombinant protein production, bacterial expression systems have been successfully used to produce biologically active mouse proteins. For example, recombinant mouse OB protein was "overexpressed and purified to near homogeneity from a bacterial expression system" and demonstrated biological activity when administered to mice .

For membrane proteins like EBP, several expression systems may be considered:

Expression SystemAdvantagesDisadvantages
E. coliHigh yield, cost-effective, simple cultivationLimited post-translational modifications, potential for inclusion bodies
Insect cellsBetter folding of mammalian proteins, some post-translational modificationsMore complex cultivation, moderate yield
Mammalian cellsAuthentic post-translational modifications, proper foldingLower yield, expensive, time-consuming

When constructing expression vectors, inclusion of appropriate tags (such as His-tag or EGFP) can facilitate both purification and detection of the recombinant protein . The choice of expression system should be guided by the specific requirements for post-translational modifications and the intended use of the recombinant protein.

How can researchers effectively assess EBP enzyme activity in vitro?

Although specific methods for measuring EBP activity are not detailed in the search results, standard approaches for assessing isomerase activity can be applied:

  • Substrate depletion assays: Monitoring the decrease in Δ8-sterol substrate concentration over time

  • Product formation assays: Measuring the increase in Δ7-sterol product

  • Coupled enzyme assays: Linking the isomerization reaction to another enzyme reaction that produces a detectable signal

  • HPLC or GC-MS analysis: Separating and quantifying substrates and products

For recombinant mouse TNF-alpha, bioactivity is assessed through specific assays measuring cytotoxicity in L929 cells, with an ED50 of 8-50 pg/mL . Similarly, specialized bioactivity assays for EBP would need to be developed based on its specific enzymatic function.

What are the considerations for designing in vivo experiments to study EBP function?

When designing in vivo experiments to study EBP function, several considerations should be made:

  • Animal model selection: Mouse models are commonly used for studying mammalian proteins. The choice between wild-type, knockout, or transgenic models depends on the specific research question.

  • Tissue-specific expression: Based on studies of the EBP-like gene in chickens, liver is a key site of expression . In mammals, steroidogenic tissues would also be of interest.

  • Developmental timing: Expression patterns change during development, as observed with the significant increase of EBP-like during peak-laying stage in chickens . Similar developmental considerations may apply to mammals.

  • Hormonal regulation: Estrogen significantly upregulates EBP-like expression in chicken models . Experimental designs should consider hormonal status and potentially include hormone administration protocols.

  • Measurement endpoints: These should include gene expression analysis (qRT-PCR), protein levels (Western blot), enzyme activity assays, and metabolite analysis (cholesterol and sterol intermediates) .

How do researchers control for variability in EBP expression across different experimental contexts?

To control for variability in EBP expression:

  • Standardized cell culture conditions: When performing in vitro experiments, standardize serum starvation periods (e.g., 6 hours as used in EBP-like studies) before treatments .

  • Multiple biological replicates: Studies on EBP-like used 4-6 biological replicates for in vivo experiments and at least three independent repetitions for in vitro work .

  • Appropriate controls: For overexpression studies, use empty vector controls (e.g., pcDNA3.1-blank). For siRNA experiments, use non-targeting siRNA (negative control) .

  • Consistent transfection methods: For cell culture experiments, standardize transfection protocols and reagents, such as using TurboFect transfection reagent for consistent delivery .

  • Normalized gene expression: Use appropriate housekeeping genes for qRT-PCR normalization to account for variations in RNA quantity and quality.

What are the potential therapeutic applications of modulating EBP activity?

Given EBP's role in cholesterol biosynthesis, modulating its activity could have therapeutic implications for:

  • Disorders of cholesterol metabolism: Since EBP catalyzes a critical step in cholesterol synthesis, inhibiting its activity might reduce cholesterol production, potentially beneficial in hypercholesterolemia.

  • X-linked disorders associated with EBP mutations: Understanding EBP function could lead to therapeutic approaches for genetic disorders caused by EBP mutations .

  • Cancer therapy: Many cancer cells show altered cholesterol metabolism; targeting EBP might disrupt cholesterol homeostasis in cancer cells.

  • Developmental disorders: Since proper cholesterol synthesis is essential for embryonic development, understanding EBP's role could provide insights into developmental disorders.

How might modern techniques like CRISPR-Cas9 advance our understanding of EBP function?

CRISPR-Cas9 technology offers powerful approaches for studying EBP function:

  • Precise gene editing: Creating specific mutations or deletions in the EBP gene to study structure-function relationships.

  • Conditional knockouts: Generating tissue-specific or inducible EBP knockout models to study its role in different contexts without embryonic lethality if constitutive knockout is lethal.

  • Tagged endogenous protein: Adding tags to the endogenous EBP gene for visualization or purification without overexpression artifacts.

  • High-throughput screening: CRISPR screening to identify genes that interact with EBP or compensate for its loss.

  • Humanized mouse models: Replacing mouse EBP with human EBP to study human-specific aspects of its function or human disease mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.