Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 2 (Ptplb)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Fatty Acid Metabolism

HACD2 catalyzes the third step (dehydration) in the elongation of long-chain fatty acids (LCFAs) to very long-chain fatty acids (VLCFAs) in the endoplasmic reticulum . This process is essential for membrane phospholipid synthesis and lipid diversity.

Key Findings

  • Redundancy with HACD1: HACD1 and HACD2 share functional overlap in saturated and monounsaturated fatty acid elongation, with HACD2 being the dominant isoform .

  • Mitochondrial Dependence: Hacd2 deficiency in mice causes embryonic lethality (E9.5) and postnatal mitochondrial dysfunction, including reduced respiratory control ratios and cardiolipin oxidation .

  • miRNA Regulation: miR-216a directly targets HACD2, altering fatty acid profiles in fatty liver disease models (e.g., increased saturated C14:0 and C17:0; decreased unsaturated C18:2n6c) .

Experimental Models

ToolApplicationSource
Recombinant ProteinEnzymatic assays, structural studies, antibody validation Creative BioMart, Cusabio
AAV VectorsOverexpression in vivo (e.g., CMV promoter, GFP reporter) Vector Biolabs
AntibodiesWestern blot, IHC, ELISA (e.g., ABIN1810105, ABIN2621701) Antibodies-Online

Disease Relevance

  • Myopathies: HACD1 mutations cause congenital myopathies, but HACD2’s broader tissue expression suggests potential roles in systemic disorders .

  • Cancer: HACD2 interacts with FBXO8 and TM9SF3, implicated in hepatocellular carcinoma progression .

Ethical Notes

Not approved for human consumption; strictly for research use .

Comparative Analysis of HACD Isoforms

FeatureHACD1HACD2
Tissue ExpressionMuscle-specific Ubiquitous
FA ElongationSaturated and monounsaturated FAsBroad activity (saturated, polyunsaturated)
Disease AssociationCongenital myopathy Mitochondrial dysfunction, fatty liver

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Hacd2; Ptplb; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 2; 3-hydroxyacyl-CoA dehydratase 2; HACD2; Protein-tyrosine phosphatase-like member B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-254
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Hacd2
Target Protein Sequence
AAAAATAATKGNGGGSGRVGAGDSSGARKKKGPGPVATAYLVIYNVVMTAGWLVIAVGLV RAYLAKGSYHSLYYSIERPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAV THSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYIIKWARYTLFIVLYPMGVT GELLTIYAALPFVRQAGLYSISLPNKYNFSFDYHAFLILIMISYIPLFPQLYFHMIHQRR KVLSHTEEHKKFE
Uniprot No.

Target Background

Function
This enzyme catalyzes the third step in the very long-chain fatty acid (VLCFA) elongation four-step cycle (condensation, reduction, dehydration, and reduction). This endoplasmic reticulum-elongation process involves the addition of two carbons to the lipid chain with each cycle. Specifically, this enzyme catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA during each elongation cycle. Therefore, it participates in the production of various VLCFAs involved in numerous biological processes as precursors of membrane lipids and lipid mediators.
Database Links
Protein Families
Very long-chain fatty acids dehydratase HACD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of 3-Hydroxyacyl-CoA Dehydratase 2 (HACD2/Ptplb) in mouse metabolism?

3-Hydroxyacyl-CoA Dehydratase 2 (HACD2/Ptplb) is a critical enzyme in the fatty acid elongation pathway, specifically catalyzing the dehydration of 3-hydroxyacyl-CoAs to trans-2-enoyl-CoAs during the third step of very long-chain fatty acid (VLCFA) synthesis. It exhibits broad substrate specificity, acting on saturated, monounsaturated, and polyunsaturated 3-OH acyl-CoAs of long to very long-chain fatty acids, with HACD2 demonstrating greater activity than other HACD family members (HACD1, HACD3, and HACD4) . This enzyme plays a particularly important role in the endoplasmic reticulum-based elongation process that extends fatty acid chain length beyond C16-C18.

How does HACD2/Ptplb differ from other members of the HACD family?

HACD2/Ptplb exhibits several distinctive characteristics compared to other HACD family members:

What experimental approaches are used to measure HACD2/Ptplb activity?

Measuring HACD2/Ptplb enzymatic activity typically involves indirect assessment through fatty acid elongation assays rather than direct measurement of 3-OH acyl-CoA dehydratase activity. Common experimental approaches include:

  • Yeast complementation systems: Using genetically modified yeast strains with impaired endogenous 3-OH acyl-CoA dehydratase activity (Phs1) to express mouse HACD2/Ptplb and assess its ability to restore fatty acid elongation .

  • LC-MS/MS analysis: Employing liquid chromatography-tandem mass spectrometry with stable isotope-labeled substrates (e.g., 13C-labeled malonyl-CoA) to track the formation of elongated fatty acid products and accumulation of 3-OH acyl-CoA intermediates .

  • Coupled enzyme assays: Measuring HACD2 activity through coupled reactions where the conversion of 3-hydroxyacyl-CoA to trans-2-enoyl-CoA is linked to another enzymatic reaction whose product can be more readily detected.

  • Knockout/knockdown studies: Assessing changes in fatty acid profiles and 3-OH acyl-CoA dehydratase activity in tissues from HACD2/Ptplb knockout or knockdown models compared to wild-type controls .

How should researchers design experiments to accurately assess recombinant HACD2/Ptplb activity in vitro?

When designing experiments to assess recombinant HACD2/Ptplb activity in vitro, researchers should consider several factors:

  • Expression system selection: Choose an appropriate heterologous expression system (bacterial, insect, or mammalian cells) based on the need for post-translational modifications and proper protein folding. For membrane proteins like HACD2/Ptplb, mammalian or insect cell expression systems often yield better functional protein.

  • Substrate selection: Utilize a range of fatty acyl-CoA substrates of varying chain lengths and saturation levels to comprehensively characterize enzyme activity, as HACD2/Ptplb exhibits broad substrate specificity toward saturated, monounsaturated, and polyunsaturated 3-OH acyl-CoAs .

  • Assay conditions optimization:

    • Buffer composition: Test different pH values, ionic strengths, and cofactor concentrations

    • Temperature: Typically 30-37°C for mammalian enzymes

    • Reaction time: Establish linearity range for accurate kinetic analysis

  • Controls and validation:

    • Include enzymatically inactive HACD2/Ptplb mutants as negative controls

    • Use purified yeast Phs1 as a positive control and activity benchmark

    • Validate results using multiple complementary assay methods

  • Detection method selection: Choose between:

    • Spectrophotometric assays (if coupled to NAD(P)H-producing/consuming reactions)

    • HPLC or LC-MS/MS for direct product analysis

    • Radioisotope-labeled substrate assays for high sensitivity

What variables should be controlled when comparing wild-type and mutant forms of HACD2/Ptplb?

When comparing wild-type and mutant forms of HACD2/Ptplb, researchers must carefully control the following variables to ensure valid comparisons:

  • Protein expression levels: Quantify protein expression by Western blotting with appropriate antibodies and normalize activity measurements to protein abundance to account for expression differences between constructs.

  • Protein localization: Verify proper subcellular localization (primarily endoplasmic reticulum) through immunofluorescence or subcellular fractionation, as mislocalization could affect apparent activity.

  • Protein stability and folding: Assess thermal stability and proper folding using techniques such as circular dichroism or limited proteolysis to ensure that activity differences are not due to structural instability.

  • Assay conditions: Maintain identical reaction conditions (pH, temperature, substrate concentrations, reaction time) across all samples to enable direct comparison.

  • Substrate saturation: Perform assays at saturating substrate concentrations to measure maximum activity (Vmax) unless specifically studying kinetic parameters.

  • Background activity elimination: Use appropriate enzyme-free and substrate-free controls to correct for background signals in the assay system.

  • Technical and biological replication: Include sufficient technical replicates (minimum 3) and biological replicates (different protein preparations) to account for random variation.

How can researchers effectively use HACD2/Ptplb knockout models to study fatty acid elongation pathways?

Effective utilization of HACD2/Ptplb knockout models for studying fatty acid elongation pathways requires a comprehensive experimental approach:

  • Validation of knockout efficiency:

    • Confirm gene disruption by genomic PCR and sequencing

    • Verify absence of protein expression by Western blotting

    • Measure residual 3-OH acyl-CoA dehydratase activity to assess potential compensation by other HACD family members

  • Comprehensive lipid profiling:

    • Analyze fatty acid composition changes using gas chromatography-mass spectrometry (GC-MS)

    • Perform targeted lipidomics to assess alterations in specific lipid classes containing VLCFAs

    • Compare profiles across multiple tissues to identify tissue-specific effects

  • Functional compensation assessment:

    • Measure expression levels of other HACD family members (HACD1, HACD3, HACD4) to detect potential compensatory upregulation

    • Create double or triple knockout models to overcome functional redundancy (e.g., HACD1/HACD2 double knockout)

  • Pathway flux analysis:

    • Perform stable isotope-labeled fatty acid incorporation studies to measure elongation rates in vivo

    • Analyze accumulation of pathway intermediates to identify rate-limiting steps

  • Phenotypic characterization:

    • Assess tissue-specific phenotypes relevant to VLCFA function (e.g., skin barrier function, myelination, retinal development)

    • Analyze developmental timing of phenotype onset

This approach has revealed that while HACD1 is highly expressed in skeletal muscle, knockout mice show only modest reductions in 3-OH acyl-CoA dehydratase activity (~40% reduction in homozygous knockouts), suggesting functional compensation by other HACD family members, particularly HACD2 .

How does substrate specificity of HACD2/Ptplb compare to other enzymes in the fatty acid elongation pathway?

The substrate specificity of HACD2/Ptplb exhibits distinctive characteristics compared to other enzymes in the fatty acid elongation pathway:

  • Broad substrate range: HACD2/Ptplb demonstrates activity toward 3-OH acyl-CoAs derived from saturated, monounsaturated, and polyunsaturated fatty acids, functioning across long- to very long-chain substrates . This broad specificity contrasts with some other enzymes in the pathway that show stronger preferences for particular fatty acid types.

  • Activity comparison with other HACDs:

HACD Family MemberSaturated FA ElongationMonounsaturated FA ElongationPolyunsaturated FA ElongationRelative Activity Level
HACD1ActiveActiveActiveModerate
HACD2ActiveActiveActiveHigh
HACD3Weakly activeWeakly activeNot detectedVery low
HACD4Not detectedNot detectedNot detectedNone detected
  • Relationship to other elongation enzymes: While HACD2/Ptplb exhibits broad substrate specificity, other enzymes in the fatty acid elongation pathway may show more restricted preferences:

    • Elongases (ELOVL1-7): Demonstrate relatively strict specificity for fatty acid chain length and saturation status

    • 3-ketoacyl-CoA reductases (KAR/HSD17B12): Show broader substrate specificity similar to HACD2

    • Trans-2-enoyl-CoA reductases (TECR/TER): Exhibit relatively broad specificity but with tissue-specific variants

  • Evolutionary conservation: The broad substrate specificity of HACD2/Ptplb is evolutionarily conserved, as evidenced by its ability to functionally complement yeast Phs1, despite the substantial evolutionary distance between yeast and mammals .

This broad substrate specificity may explain why HACD2/Ptplb appears to be the predominant 3-hydroxyacyl-CoA dehydratase in many tissues, providing versatility in supporting various fatty acid elongation pathways.

What are the most effective approaches for resolving contradictory data regarding HACD2/Ptplb function?

When faced with contradictory data regarding HACD2/Ptplb function, researchers should employ a systematic approach to resolve discrepancies:

  • Methodological reconciliation:

    • Directly compare experimental protocols, focusing on differences in assay conditions, substrate preparation, enzyme sources, and detection methods

    • Replicate published experiments using identical materials and methods when possible

    • Develop standardized protocols that can be adopted across laboratories to reduce variability

  • Multi-system validation:

    • Test HACD2/Ptplb function across multiple experimental systems (in vitro purified enzyme, cell-based assays, animal models)

    • Compare results between heterologous expression systems (bacterial, yeast, insect, and mammalian cells)

    • Validate findings in relevant primary cells that naturally express HACD2/Ptplb

  • Comprehensive genetic approaches:

    • Generate conditional and tissue-specific knockout models to address potential developmental adaptation or compensation

    • Create knockin models expressing tagged HACD2/Ptplb to study endogenous protein interactions and localization

    • Utilize CRISPR/Cas9 genome editing to introduce specific mutations to test structure-function hypotheses

  • Integrated omics analysis:

    • Combine transcriptomics, proteomics, and lipidomics data to generate comprehensive pathway models

    • Apply systems biology approaches to identify contextual factors affecting HACD2/Ptplb function

    • Use computational modeling to predict conditions under which contradictory results might be reconciled

  • Collaborative cross-validation:

    • Establish collaborations between laboratories reporting contradictory results

    • Exchange key reagents (plasmids, antibodies, cell lines) to eliminate reagent variability

    • Conduct blinded analyses of samples to reduce experimental bias

For example, contradictory results regarding the importance of HACD2/Ptplb in certain tissues could be resolved by comparing single knockout models (which may show compensation by other HACD family members) with double or triple knockout models that eliminate redundant activities .

What techniques are most appropriate for studying the interaction between HACD2/Ptplb and other components of the fatty acid elongation complex?

Studying protein-protein interactions within the fatty acid elongation complex requires specialized techniques suitable for membrane-associated proteins like HACD2/Ptplb:

  • Proximity-based labeling techniques:

    • BioID or TurboID: Fusion of biotin ligase to HACD2/Ptplb to biotinylate proximal proteins in living cells

    • APEX2: Peroxidase-based proximity labeling followed by mass spectrometry to identify neighboring proteins

    • These methods are particularly valuable for identifying transient interactions within membrane-embedded complexes

  • Co-immunoprecipitation optimization for membrane proteins:

    • Crosslinking prior to solubilization (using DSP, formaldehyde, or photo-activatable crosslinkers)

    • Careful selection of detergents (digitonin, DDM, or CHAPS) that preserve protein-protein interactions

    • Native co-IP using epitope-tagged HACD2/Ptplb expressed at endogenous levels

  • Advanced microscopy approaches:

    • FRET (Förster Resonance Energy Transfer) to assess direct protein interactions

    • FCCS (Fluorescence Cross-Correlation Spectroscopy) to analyze co-diffusion of labeled proteins

    • Super-resolution microscopy (PALM, STORM) to visualize nanoscale co-localization

  • Functional reconstitution systems:

    • Reconstitution of fatty acid elongation components in proteoliposomes

    • Cell-free expression systems for simultaneous production of multiple complex components

    • Yeast complementation with co-expressed elongation complex proteins

  • Structural biology approaches:

    • Cryo-electron microscopy of purified elongation complexes

    • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

These techniques have revealed that HACD2/Ptplb operates within a multi-enzyme complex in the endoplasmic reticulum, interacting with other components of the fatty acid elongation machinery including 3-ketoacyl-CoA reductases (KAR/HSD17B12) and trans-2-enoyl-CoA reductases (TECR/TER) .

What are common pitfalls in recombinant HACD2/Ptplb expression and purification, and how can they be addressed?

Researchers frequently encounter several challenges when expressing and purifying recombinant HACD2/Ptplb, a membrane-embedded enzyme:

  • Low expression levels:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for expression host; use stronger promoters; test expression in multiple systems (bacterial, yeast, insect, mammalian); consider fusion tags (MBP, SUMO) that enhance solubility; reduce expression temperature to allow proper folding

  • Protein misfolding and aggregation:

    • Problem: Improper folding leading to inclusion body formation or aggregation

    • Solution: Express in eukaryotic systems with appropriate chaperones; use mild solubilization conditions; introduce stabilizing mutations based on computational prediction; employ fusion partners that promote proper folding

  • Inefficient membrane extraction:

    • Problem: Incomplete solubilization from membranes

    • Solution: Screen multiple detergents systematically (DDM, LMNG, GDN); optimize detergent:protein ratio; consider detergent mixtures; use lipid-detergent mixed micelles to maintain native environment

  • Loss of activity during purification:

    • Problem: Enzyme inactivation during purification steps

    • Solution: Minimize purification steps; maintain critical lipids throughout purification; include stabilizing agents (glycerol, specific lipids); avoid freeze-thaw cycles; purify at 4°C; consider purifying the entire elongation complex rather than individual components

  • Heterogeneity of purified product:

    • Problem: Multiple oligomeric states or conformations

    • Solution: Use size-exclusion chromatography to isolate homogeneous populations; analyze by multi-angle light scattering to determine oligomeric state; verify functional activity of different fractions

A recommended optimization strategy is to initially focus on establishing functional activity in membrane fractions before attempting extensive purification, as demonstrated in studies of HACD2/Ptplb activity in microsomal preparations from yeast expressing the recombinant enzyme .

How can researchers distinguish between primary effects of HACD2/Ptplb modulation and secondary metabolic adaptations?

Distinguishing primary effects of HACD2/Ptplb modulation from secondary adaptations requires specialized experimental designs:

  • Temporal analysis approaches:

    • Inducible expression/knockdown systems: Use temporally controlled gene expression systems (Tet-On/Off, CRE-ERT2) to observe immediate effects before compensatory mechanisms engage

    • Time-course studies: Sample at multiple time points following HACD2/Ptplb modulation to differentiate immediate from delayed effects

    • Pulse-chase experiments: Track labeled fatty acid metabolism immediately after modulation versus long-term adaptation

  • Direct vs. indirect effect discrimination:

    • In vitro reconstitution: Reconstitute purified components to demonstrate direct enzymatic effects

    • Substrate trapping mutants: Generate catalytically inactive HACD2/Ptplb variants that bind but don't process substrates to identify direct interactors

    • Metabolic flux analysis: Use stable isotope-labeled precursors to distinguish altered flux through primary pathways versus compensatory pathways

  • Genetic complementation strategies:

    • Rescue experiments: Reintroduce wild-type or mutant HACD2/Ptplb into knockout models to confirm direct causality

    • Structure-function studies: Create targeted mutations affecting specific functions to dissect multifunctional effects

    • Heterologous expression: Test mammalian HACD2/Ptplb in yeast Phs1 mutants to assess conserved functions in a simplified system

  • Multi-omics integration:

    • Correlative analysis: Integrate transcriptomics, proteomics, and lipidomics data to distinguish primary pathway perturbations from secondary adaptations

    • Network analysis: Apply pathway analysis tools to identify directly affected nodes versus downstream consequences

    • Computational modeling: Develop predictive models of expected primary effects for comparison with experimental data

This systematic approach can help researchers differentiate between direct consequences of HACD2/Ptplb activity changes and secondary metabolic rewiring, as demonstrated in studies comparing acute versus chronic effects of HACD2 deletion .

What statistical approaches are most appropriate for analyzing HACD2/Ptplb activity data across different experimental conditions?

Selecting appropriate statistical methods for analyzing HACD2/Ptplb activity data requires consideration of experimental design and data characteristics:

  • Parametric vs. non-parametric methods:

    • Parametric tests (t-tests, ANOVA): Appropriate when data follow normal distribution and exhibit homogeneity of variance

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis): Preferred when normality cannot be assumed or with small sample sizes

    • Recommendation: Test for normality (Shapiro-Wilk test) and equal variances (Levene's test) before selecting approach

  • Multiple comparison considerations:

    • Problem: When comparing multiple conditions (e.g., wild-type vs. various mutants), the risk of false positives increases

    • Solutions: Apply Bonferroni, Tukey, or Dunnett corrections for multiple comparisons; control false discovery rate using Benjamini-Hochberg procedure

    • Example application: When comparing HACD2 activity across multiple tissues or with different substrates

  • Regression and correlation approaches:

    • Linear regression: For analyzing relationships between enzyme concentration and activity, or substrate concentration and reaction velocity

    • Non-linear regression: For enzyme kinetic modeling (Michaelis-Menten, allosteric models)

    • Correlation analysis: To assess relationships between HACD2 expression levels and fatty acid profiles

  • Advanced statistical methods for complex datasets:

    • Mixed-effects models: For analyzing data with both fixed effects (e.g., treatment, genotype) and random effects (e.g., biological replicates, litter effects)

    • Principal component analysis (PCA): To identify patterns in multivariate datasets (e.g., lipidomics data from HACD2 knockout models)

    • Multivariate ANOVA (MANOVA): When analyzing multiple dependent variables simultaneously

  • Experimental design considerations:

    • Power analysis: Determine appropriate sample sizes to detect biologically significant effects

    • Randomization and blinding: Minimize bias in sample preparation and analysis

    • Technical vs. biological replicates: Properly account for different sources of variation in statistical modeling

When analyzing complex phenotypes resulting from HACD2/Ptplb modulation, multivariate approaches are particularly valuable as they can capture correlated changes across multiple fatty acid species and lipid classes that might be missed by univariate statistics .

What are the emerging techniques for studying HACD2/Ptplb regulation in physiologically relevant contexts?

Cutting-edge approaches for investigating HACD2/Ptplb regulation in physiological contexts include:

  • Advanced genetic models:

    • Tissue-specific inducible knockouts: Using Cre-ERT2 systems for temporal and spatial control of HACD2/Ptplb expression

    • Knockin reporter lines: Creating endogenous fusions with fluorescent proteins or enzymatic tags to monitor expression, localization, and turnover

    • Humanized mouse models: Replacing mouse HACD2/Ptplb with human variants to study species-specific functions and disease-associated mutations

  • Single-cell approaches:

    • Single-cell RNA-seq: Analyzing cell-type-specific expression patterns of HACD2/Ptplb and co-regulated genes

    • Single-cell proteomics: Determining protein abundance at individual cell resolution

    • Single-cell lipidomics: Measuring fatty acid elongation products in individual cells to capture heterogeneity

  • Advanced imaging technologies:

    • Live-cell imaging: Using fluorescent biosensors to monitor enzyme activity or substrate levels in real-time

    • Correlative light and electron microscopy (CLEM): Combining functional imaging with ultrastructural analysis

    • Expansion microscopy: Achieving super-resolution visualization of HACD2/Ptplb within the ER membrane

  • Physiological regulation studies:

    • Metabolic flux analysis in primary tissues: Using stable isotope-labeled precursors to measure elongation pathway activity

    • Organoid models: Studying HACD2/Ptplb in 3D tissue models that recapitulate physiological organization

    • Environmental perturbation: Analyzing HACD2/Ptplb regulation under physiologically relevant stressors (fasting, cold exposure, inflammation)

  • Systems biology integration:

    • Multi-omics profiling: Combining transcriptomics, proteomics, lipidomics, and metabolomics datasets

    • Network inference algorithms: Identifying regulatory relationships affecting HACD2/Ptplb activity

    • Computational modeling: Developing predictive models of fatty acid elongation under various physiological conditions

These approaches promise to reveal context-dependent regulation of HACD2/Ptplb that may be missed in conventional studies, potentially explaining tissue-specific phenotypes observed in knockout models .

How can researchers effectively combine in vitro and in vivo approaches to develop a comprehensive understanding of HACD2/Ptplb function?

Developing a comprehensive understanding of HACD2/Ptplb function requires strategic integration of in vitro and in vivo approaches:

  • Structural-functional correlation strategy:

    • In vitro: Determine structure-function relationships through site-directed mutagenesis and activity assays with purified components

    • In vivo: Generate knockin mice expressing the same mutants to validate functional consequences in physiological context

    • Integration: Map molecular mechanisms defined in vitro to phenotypic outcomes observed in vivo

  • Substrate specificity characterization:

    • In vitro: Define substrate preferences using purified enzyme with diverse acyl-CoA substrates

    • In vivo: Analyze fatty acid composition in tissues from wild-type and HACD2/Ptplb-deficient mice

    • Integration: Correlate in vitro substrate preferences with specific fatty acid species altered in vivo

  • Interaction networks mapping:

    • In vitro: Identify direct protein interactions through techniques like crosslinking mass spectrometry

    • In vivo: Perform proximity labeling in cells/tissues to capture the endogenous interactome

    • Integration: Distinguish core interactions (consistent between systems) from context-dependent ones

  • Regulatory mechanism elucidation:

    • In vitro: Determine how potential regulatory factors (substrates, products, cofactors) affect purified enzyme activity

    • In vivo: Analyze HACD2/Ptplb expression, localization, and activity under various physiological conditions

    • Integration: Develop mathematical models that predict in vivo behavior based on in vitro regulatory mechanisms

  • Translational validation pipeline:

    • In vitro: Screen compounds for modulation of HACD2/Ptplb activity

    • Cell models: Validate effects in relevant cell types

    • In vivo: Confirm physiological impact in animal models

    • Integration: Establish biomarkers that track from in vitro to in vivo systems

This integrated approach has successfully revealed that while HACD2/Ptplb shows broad substrate specificity in vitro, its physiological role may be more selective in vivo, with tissue-specific effects on particular fatty acid species, likely due to the composition of the complete elongation machinery in different cellular contexts .

What are the most promising approaches for translating basic HACD2/Ptplb research into therapeutic applications?

Translating fundamental HACD2/Ptplb research into therapeutic applications requires strategic approaches that bridge basic science and clinical development:

  • Target validation strategies:

    • Genetic association studies: Identify human HACD2/PTPLB variants associated with disease phenotypes

    • Tissue-specific conditional knockouts: Establish causal relationships between HACD2 activity and disease-relevant phenotypes

    • Patient-derived samples: Analyze HACD2 expression/activity in affected versus healthy tissues

  • Drug discovery approaches:

    • Structure-based drug design: Utilize structural information to develop small molecule modulators

    • High-throughput screening: Develop assays suitable for screening compound libraries

    • Allosteric modulator identification: Target regulatory sites rather than the catalytic center

    • Biotherapeutic approaches: Develop antibodies or other biologics that modulate HACD2/Ptplb activity or expression

  • Pathway-centric therapeutic strategies:

    • Metabolic bypass approaches: Identify alternative pathways that can compensate for HACD2/Ptplb dysfunction

    • Substrate reduction therapy: Target upstream enzymes to reduce accumulation of toxic intermediates

    • Product supplementation: Provide downstream metabolites to bypass pathway defects

  • Precision medicine applications:

    • Biomarker development: Identify fatty acid profiles that predict response to HACD2/Ptplb-targeting therapies

    • Patient stratification: Classify patients based on mechanism of HACD2/Ptplb dysfunction

    • Theranostic approaches: Develop companion diagnostics alongside therapeutic interventions

  • Advanced therapeutic modalities:

    • Gene therapy: Develop viral vectors for HACD2/Ptplb delivery to affected tissues

    • RNA therapeutics: Design antisense oligonucleotides or siRNAs to modulate HACD2/Ptplb expression

    • Enzyme replacement therapy: Engineer recombinant HACD2/Ptplb with improved stability and cellular uptake

These approaches could be particularly relevant for disorders involving abnormal fatty acid metabolism, such as certain forms of neuropathy, ichthyosis, or metabolic disorders where very long-chain fatty acids play important roles in tissue function. The fundamental understanding of HACD2/Ptplb's role in fatty acid elongation, as demonstrated by knockout studies and enzymatic characterization, provides the foundation for these translational efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.