Recombinant Mouse 3-hydroxyacyl-CoA dehydratase 3 (ptplad1)

Shipped with Ice Packs
In Stock

Description

Role in Lipid Metabolism

  • VLCFA Synthesis: PTPLAD1 deficiency in Arabidopsis homolog PAS2 reduces VLCFA levels in sphingolipids, waxes, and triacylglycerols, confirming its conserved role across species .

  • Embryonic Lethality: Complete loss of PTPLAD1 function in mice results in embryonic lethality, underscoring its necessity in development .

Viral Replication Modulation

  • Influenza A Virus (IAV): PTPLAD3 stabilizes viral PB1 protein by competing with autophagy receptor SQSTM1/p62, preventing PB1 degradation and enhancing viral replication .

  • Hepatitis C Virus (HCV): Interacts with viral NS5A protein to support replication, indicating broad roles in viral pathogenesis .

Signaling Pathways

  • Insulin Receptor Regulation: Promotes insulin receptor (INSR) autophosphorylation and internalization, linking VLCFA synthesis to metabolic signaling .

  • Rac1 Signaling: Modulates gene expression via Rac1 pathways, influencing cell differentiation and stress responses .

Recombinant Expression Systems

Adenovirus-Based Expression

  • Vector: Human Adenovirus Type 5 (dE1/E3) with CMV promoter .

  • Applications: Used for overexpression studies in mammalian cells to investigate lipid metabolism and viral replication mechanisms .

Experimental Uses

  • Fatty Acid Elongation Studies: Reconstitution of elongase activity in proteoliposomes .

  • Autophagy Pathways: Investigating PB1-SQSTM1/p62 interactions in viral replication .

  • Gene Silencing: siRNA knockdown models to study metabolic and developmental defects .

Key Findings from Overexpression

  • VLCFA Overproduction: Causes leaf deformation, wax crystal accumulation, and carpel defects in plants, highlighting PTPLAD1's role as a rate-limiting enzyme .

  • Cell Cycle Dysregulation: Ectopic expression disrupts cyclin-dependent kinase (CDK) dephosphorylation, delaying mitotic entry .

Clinical and Biotechnological Relevance

Metabolic Disorders

  • Mutations in PTPLAD1 homologs are linked to impaired VLCFA synthesis, contributing to conditions like ichthyosis and neurodegeneration .

  • Type-2 Diabetes Risk: Human HACD3 variants correlate with insulin resistance, suggesting therapeutic potential .

Virology

  • Antiviral Targets: Blocking PTPLAD1-PB1 interaction reduces IAV replication efficiency, identifying it as a drug target .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it when placing the order and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize development with the specified tag.
Synonyms
Hacd3; Ptplad1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Butyrate-induced protein 1; B-ind1; Protein-tyrosine phosphatase-like A domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Hacd3
Target Protein Sequence
METQVLTPHVYWAQRHRELYLRVELSDVQNPAISITDNVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPAYRLTQRQVNITVQKKGSHWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLEREGSPETLTNLKKGYLFMYNLVQLLGFSWIFVNLTVRFFILGKESF YDTFHNVADMMYFCQMLALVETLNAAIGVTSTPVLPALIQFLGRNFILFLVFGTMEEMQN KAVVFFVFYSWSAIEIFRYPFYMLSCIDMDWKVLTWLRYTMWIPLYPLGCLSEAVAVIQS IPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLGLYINFRHLYKQRRRRYGQKKKK LH
Uniprot No.

Target Background

Function
This endoplasmic reticulum-bound enzyme catalyzes the third step in the long-chain fatty acids elongation cycle. This process involves adding two carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Specifically, it catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate into trans-2,3-enoyl-CoA, within each elongation cycle. This enzyme contributes to the production of VLCFAs of varying chain lengths, which are essential components of membrane lipids and lipid mediators. Additionally, it is involved in Rac1-signaling pathways that modulate gene expression, promoting insulin receptor (INSR) autophosphorylation and playing a role in INSR internalization.
Database Links
Protein Families
Very long-chain fatty acids dehydratase HACD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What are the common methods for studying PTPLAD1 expression patterns?

Several approaches can be used to study PTPLAD1 expression:

Immunoblotting (Western Blot):

  • Use validated antibodies like monoclonal antibody clone 5B5 (recognized epitope: amino acids 1-113)

  • Include appropriate positive controls such as recombinant PTPLAD1 protein

  • For subcellular distribution analysis, perform fractionation before immunoblotting

Immunofluorescence:

  • Fixation with 4% paraformaldehyde followed by permeabilization

  • Use antibody concentration of approximately 10 μg/ml as demonstrated effective in HeLa cells

  • Co-stain with organelle markers (e.g., mitochondrial, ER markers) to determine precise localization

Gene Expression Analysis:

  • qRT-PCR using validated primers for mouse Ptplad1

  • RNA-seq to analyze transcriptional regulation in different physiological contexts

Tissue Expression:

  • Immunohistochemistry (IHC) using paraffin-embedded or frozen tissue sections

  • Analysis of expression in different disease states, particularly cancer progression stages

What recombinant forms of mouse PTPLAD1 are available for research?

Several recombinant forms are available for different experimental applications:

FormTagExpression SystemApplicationsReference
Full-length (1-362 aa)HisE. coliEnzymatic assays, antibody validation
Full-lengthHis(Fc)-AviUnspecifiedProtein interaction studies
Pre-coupled to magnetic beadsN/AN/AImmunoassays, protein purification
Adenovirus expression vectorOptional GFP, CFP, YFP, RFP or mCherryN/AOverexpression studies in cells

For immunoprecipitation or pull-down experiments, magnetic bead-coupled PTPLAD1 offers advantages including:

  • Particle size: ~2 μm

  • Hydrophilic bead surface

  • Binding capacity: >200 pmol rabbit IgG/mg beads

  • Storage stability: at least 6 months at 2-8°C

How does PTPLAD1 contribute to insulin receptor trafficking and signaling?

PTPLAD1 plays a sophisticated role in insulin receptor (IR) trafficking and signaling through several mechanisms:

Effects on IR Phosphorylation and Activity:

  • PTPLAD1 exhibits protein tyrosine phosphatase activity that influences IR phosphorylation status

  • Overexpression of PTPLAD1 affects IR association with signaling components

  • When PTPLAD1 is overexpressed, there is a decrease in IR association with Rab5c at basal conditions (fold decrease 45±9.5, p≤0.01)

Cytoskeletal Interactions:

  • PTPLAD1 functions as an "insulin-dependent switch" determining IR interaction with either:

    • Microtubules (tubulin alpha/beta)

    • Actin routing components

  • This switching mechanism is crucial for proper endosomal trafficking of IR

Experimental evidence:

  • PTPLAD1 siRNA knockdown experiments show altered IR association with ACTβ (fold increase 420±47 with insulin stimulation, p≤0.001)

  • PTPLAD1 works in concert with Cdk2 to regulate different aspects of IR trafficking:

    • Cdk2 primarily controls microtubule-based traffic

    • PTPLAD1 determines cytoskeletal routing preferences

These findings suggest that PTPLAD1 is a critical component of the insulin-responsive endosomal network (IREN) and may represent a novel target for modulating insulin sensitivity.

What are the controversies regarding PTPLAD1's enzymatic activities?

PTPLAD1 presents interesting enzymatic complexity with seemingly dual functions that have generated controversy in the field:

Fatty Acid Dehydratase Activity:

  • Characterized as 3-hydroxyacyl-CoA dehydratase 3 (HACD3) involved in very long-chain fatty acid synthesis

  • Catalyzes the dehydration step in VLCFA synthesis

Protein Tyrosine Phosphatase-Like Activity:

  • Despite its name suggesting PTP activity, the precise mechanism remains incompletely characterized

  • Exhibits measurable phosphatase activity with artificial substrates like p-NPP

  • Activity is inhibited by phosphatase inhibitors such as bpV(phen) at 50 μM

Reconciling Dual Activities:
The controversy centers on how a single protein can perform both functions. Several hypotheses exist:

  • Domain Separation: Different domains perform distinct enzymatic functions

  • Protein Complexes: PTPLAD1 may function within different protein complexes that determine its activity

  • Regulatory Modifications: Post-translational modifications may switch between activities

Experimental Approaches to Resolve the Controversy:

  • Site-directed mutagenesis of putative active sites for each function

  • Structural studies to determine enzyme-substrate interactions

  • Domain swapping experiments to isolate functional regions

  • Comparative studies with similar dual-function enzymes

Researchers should be aware that commercially available recombinant proteins may have different activities depending on expression systems, tags, and purification methods.

How does PTPLAD1 contribute to cancer progression mechanisms?

Recent evidence indicates PTPLAD1/HACD3 may play significant roles in cancer progression, particularly in colorectal cancer:

Regulation of PHB-Raf-ERK Signaling:

  • PTPLAD1 regulates PHB (Prohibitin) phosphorylation at Y259

  • This phosphorylation affects downstream Raf-ERK signaling

  • Knockdown of PTPLAD1 reduces phosphorylation of ERK1/2, affecting cancer cell proliferation

Effects on Epithelial-Mesenchymal Transition (EMT):

  • PTPLAD1 influences expression of EMT markers including:

    • E-cadherin (epithelial marker)

    • Vimentin (mesenchymal marker)

  • Silencing PTPLAD1 alters the invasive phenotype of colorectal cancer cells

Mitochondrial Dynamics Regulation:

  • PTPLAD1 affects expression of mitochondrial dynamics markers:

    • OPA1 (fusion)

    • MFN1/MFN2 (fusion)

    • Fis1 (fission)

  • Experimental data shows these effects can be reversed with MEK inhibitor U0126, suggesting ERK pathway dependence

Functional Studies in Cancer Models:

  • Knockdown of PTPLAD1 in HCT116 and RKO cells impairs invasion in Boyden chamber assays

  • Co-knockdown experiments with PHB suggest that PTPLAD1 acts at least partly through the PHB-Raf-ERK pathway

  • IHC studies show correlation between PTPLAD1 expression and lymph node metastasis (N stage) in colorectal cancer

These findings suggest PTPLAD1 as a potential therapeutic target in colorectal cancer, with effects on both signaling and mitochondrial function.

What are the most effective experimental approaches for manipulating PTPLAD1 expression?

Researchers have several options for manipulating PTPLAD1 expression, each with distinct advantages:

Overexpression Systems:

  • Plasmid-based expression:

    • pcDNA3 expression vector has been validated for PTPLAD1 expression

    • Transfection typically yields results within 48 hours

    • Ideal for short-term studies in easily transfectable cell lines

  • Viral vector systems:

    • Adenovirus expressing mouse PTPLAD1 (Ad-m-PTPLAD1)

    • Optional reporters: GFP, CFP, YFP, RFP, or mCherry

    • Promoter options: CMV (standard) or cell-specific promoters

    • Advantages: high transduction efficiency in difficult-to-transfect cells

Gene Silencing Approaches:

  • siRNA knockdown:

    • Validated siRNA sequences:

      • si-PTPLAD1 #1: GGAGAGACUCACAAAGCAGTT

      • si-PTPLAD1 #2: GUCCAUUCCAAUAUUCAAUTT

    • Typical knockdown duration: 48-72 hours

    • Best for acute loss-of-function studies

  • shRNA for stable knockdown:

    • Available as adenoviral vectors (shADV-269784)

    • Also available as AAV vectors for in vivo applications

    • Advantages: longer-term knockdown, selectable markers

  • CRISPR-Cas9 gene editing:

    • For complete knockout studies

    • Can be designed for conditional knockout using inducible systems

    • Consider potential compensation by related family members

Experimental Considerations:

  • Include appropriate controls: empty vectors, scrambled siRNA

  • Validate knockdown/overexpression by both protein and mRNA analysis

  • Consider potential off-target effects, especially with siRNA approaches

  • For cancer studies, use cell lines with different metastatic potentials (e.g., SW480 vs. SW620, HCT116 vs. HCT116-i8)

What are the optimal conditions for recombinant PTPLAD1 protein reconstitution and storage?

Proper handling of recombinant PTPLAD1 is critical for maintaining activity. Follow these guidelines:

Reconstitution Protocol:

  • Centrifuge the product vial briefly before opening

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot for long-term storage to avoid freeze-thaw cycles

Storage Conditions:

  • Short-term working aliquots: 4°C for up to one week

  • Long-term storage: -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this significantly reduces activity

  • For magnetic bead-coupled PTPLAD1: store at 2-8°C, do not freeze

Buffer Considerations:

  • Standard storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • For enzymatic assays: consider activity-specific buffers

Activity Preservation:

  • PTPLAD1 has dual enzymatic functions (dehydratase and phosphatase)

  • Phosphatase activity can be measured using p-NPP as substrate

  • Include phosphatase inhibitors (e.g., 50 μM bpV(phen)) as controls

How can researchers effectively analyze PTPLAD1 interactions with insulin receptor and cytoskeletal components?

Several methodological approaches can be used to study these interactions:

Co-Immunoprecipitation (Co-IP):

  • Optimize cell lysis conditions to preserve interactions:

    • For cytoskeletal interactions: use mild detergents

    • For membrane protein interactions: consider crosslinking before lysis

  • Perform reciprocal IPs with antibodies against:

    • PTPLAD1

    • Insulin receptor β (IRβ)

    • Cytoskeletal components (ACTβ, TUBA, TUBB)

    • Rab proteins (especially Rab5c)

  • Analyze by immunoblotting with specific antibodies

Example Protocol Based on Published Data:

  • Transfect cells with PTPLAD1-pcDNA3 or empty vector

  • Serum-starve for 5 hours

  • Stimulate with insulin (35 nM) for specific time points

  • Perform IP of IRβ or Cdk2

  • Blot for interaction partners

Microscopy-Based Approaches:

  • Proximity Ligation Assay (PLA):

    • Visualizes protein interactions in situ

    • Provides spatial information about where interactions occur

    • Can detect transient interactions following insulin stimulation

  • Fluorescence Resonance Energy Transfer (FRET):

    • Tag PTPLAD1 and potential partners with appropriate fluorophores

    • Measure energy transfer as indicator of proximity

    • Allows real-time monitoring of interactions

Functional Validation:

  • Overexpress or knock down PTPLAD1 and measure effects on:

    • IR trafficking (surface vs. endosomal localization)

    • Cytoskeletal organization

    • Downstream insulin signaling (e.g., Akt phosphorylation)

    • Glucose uptake

Documented interactions to investigate include:

  • PTPLAD1-IRβ-Rab5c: Shows insulin-dependent changes

  • PTPLAD1-Cdk2-Rab5c: Affected by PTPLAD1 expression levels

  • PTPLAD1-IR-ACTβ: Altered by PTPLAD1 knockdown

What are promising new areas for PTPLAD1 research?

Several emerging research directions show promise for advancing our understanding of PTPLAD1:

Structural Biology Approaches:

  • Determine crystal structure of PTPLAD1 to understand dual enzymatic functions

  • Identify binding sites for interaction partners, especially insulin receptor

  • Use structure-guided design of specific inhibitors

Systems Biology Integration:

  • Map PTPLAD1 within the insulin-responsive endosomal network (IREN)

  • Quantitative analysis of how PTPLAD1 alters network properties

  • Modeling of cytoskeletal dynamics influenced by PTPLAD1

Therapeutic Potential:

  • Development of small molecule modulators of PTPLAD1

  • Targeting PTPLAD1 in insulin resistance and type 2 diabetes

  • Exploration of PTPLAD1 inhibition in cancer treatment, particularly colorectal cancer

Technology Development:

  • Creation of biosensors to monitor PTPLAD1 activity in real-time

  • High-throughput screening platforms for PTPLAD1 modulators

  • CRISPR-based genetic screens to identify new PTPLAD1 interaction partners

Emerging Questions:

  • How does PTPLAD1 contribute to tissue-specific insulin responsiveness?

  • What is the evolutionary significance of combining fatty acid synthesis and phosphatase activities?

  • How does PTPLAD1 function change in pathological states beyond cancer and diabetes?

These directions will help resolve current controversies and potentially identify new therapeutic targets in metabolic disease and cancer.

How can researchers address challenges in PTPLAD1 functional studies?

Common challenges and their solutions:

Low Activity of Recombinant Protein:

  • Ensure proper reconstitution following manufacturer protocols

  • Test multiple expression systems (E. coli vs. mammalian)

  • Consider the impact of tags on protein folding and function

  • For phosphatase activity assays, include known PTP substrates as positive controls

Inconsistent Knockdown Results:

  • Validate siRNA efficiency by both qRT-PCR and Western blot

  • Test multiple siRNA sequences to minimize off-target effects

  • Consider timing issues—PTPLAD1 may have different half-lives in different cell types

  • Use rescue experiments with siRNA-resistant constructs to confirm specificity

Difficulty Detecting Protein Interactions:

  • Optimize lysis conditions to preserve interactions

  • Try reversible crosslinking approaches

  • Consider the timing of interactions—some may be transient after insulin stimulation

  • Use fractionation to enrich for specific cellular compartments

Variability in Cancer Cell Studies:

  • Account for heterogeneity of cancer cell lines

  • Compare paired cell lines with different metastatic potential

  • Standardize culture conditions, especially serum levels

  • Validate key findings in multiple cell lines

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.