Recombinant Mouse 3-keto-steroid reductase (Hsd17b7)

Shipped with Ice Packs
In Stock

Description

Functional Role

Hsd17b7 catalyzes two primary reactions:

  1. 3-Ketosteroid reduction: Converts zymosterone to zymosterol in cholesterol biosynthesis using NADPH as a cofactor .

  2. 17β-Hydroxysteroid dehydrogenase activity: Modulates estrogen and androgen potency by interconverting estradiol and estrone .

Key Functional Insights

  • Cholesterol biosynthesis: Complements Erg27p-deficient yeast, restoring growth on sterol-deficient media .

  • Embryonic development: Knockout mice exhibit embryonic lethality due to disrupted cholesterol-dependent Hedgehog signaling .

  • Tissue specificity: Co-expressed with HMG-CoA reductase in tissues prone to congenital cholesterol-deficiency disorders .

Table 1: Enzymatic Properties

PropertyDetail
SubstrateZymosterone (primary), 17β-estradiol (secondary)
CofactorNADPH
LocalizationEndoplasmic reticulum membrane
Kinetic ActivitySpecific activity confirmed via GST-fusion protein assays

Table 2: Key Studies

Study FocusMethodologyKey FindingsSource
Yeast ComplementationExpressed Hsd17b7 in ΔErg27 yeastRestored growth on sterol-free media
Enzyme LocalizationGFP-Hsd17b7 fusion in mammalian cellsER-specific localization
Knockout PhenotypeHsd17b7−/− miceEmbryonic lethality at E10.5
Transcriptional RegulationPromoter analysis (SREBP, SP1, NF-Y)Cholesterol-dependent expression

Pathophysiological Relevance

  • Congenital disorders: Linked to inborn errors of cholesterol metabolism (e.g., Smith-Lemli-Opitz syndrome) .

  • Therapeutic potential: Target for modulating cholesterol biosynthesis or steroid-hormone-related pathologies .

Unresolved Questions

  • Mechanistic divergence: Unlike yeast Erg27p, Hsd17b7 does not stabilize oxidosqualene cyclase (OSC) in mammals, suggesting evolutionary functional shifts .

  • Dual substrate specificity: Structural basis for its bifunctionality (cholesterol vs. steroid metabolism) remains under investigation .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate special requests for the format. Please specify your desired format in the order notes and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: Our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please inform us in advance as an additional fee will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
In general, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know and we will prioritize its development.
Synonyms
Hsd17b7; 17hsd7; 3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7; 17-beta-hydroxysteroid dehydrogenase 7; 17-beta-HSD 7; 3-keto-steroid reductase; Dihydrotestosterone oxidoreductase; Estradiol 17-beta-dehydrogenase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Hsd17b7
Target Protein Sequence
MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS
Uniprot No.

Target Background

Function
3-keto-steroid reductase (Hsd17b7) is a bifunctional enzyme involved in steroid-hormone metabolism and cholesterol biosynthesis. It catalyzes the NADP(H)-dependent reduction of estrogens and androgens, thereby regulating the biological potency of these steroids. Specifically, it converts estrone (E1) to the more potent estrogen, 17beta-estradiol (E2). It also converts dihydrotestosterone (DHT) to its inactive forms, 5a-androstane-3beta,17b-diol and 5alpha-androstane-3alpha,17beta-diol, while not metabolizing progesterone. Additionally, Hsd17b7 participates in the post-squalene cholesterol biosynthesis as a 3-ketosteroid reductase.
Gene References Into Functions
  1. The ENU-induced rudolph mouse mutant exhibits defects in both the central nervous system and skeletal development, carrying a mutation in Hsd17b7. These developmental abnormalities are attributed to disruptions in Hedgehog signaling. PMID: 21912524
  2. A recessive mutation, rudolph, causing abnormal forebrain development, was identified in the hydroxysteroid (17-beta) dehydrogenase 7 gene, an enzyme crucial for cholesterol biosynthesis. PMID: 21912524
  3. Hsd17b7 activity is essential for fetal de novo cholesterol synthesis and for neuroectodermal survival and cardiovascular differentiation during early mouse embryonic development. PMID: 20185768
  4. Comparison of the promoter regions of the human and murine gene. PMID: 15862973
  5. The identified proximal promoter regions of both human and murine HSD17B7 genes contain multiple transcription factor binding sites and exhibit strong similarity to cholesterogenic genes. PMID: 16356630
  6. Findings provide definitive evidence for the role of 17beta-hydroxysteroid dehydrogenase type-7 in cholesterol biosynthesis. PMID: 16901934
  7. Data demonstrate that prolactin receptor-associated protein/17beta-hydroxysteroid dehydrogenase type 7 plays a significant role in fetal survival and embryonic development in mice. PMID: 18669642

Show More

Hide All

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family, ERG27 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Most abundant in ovaries of pregnant animals. Present also in nonpregnant animals in ovaries, mammary gland liver, kidney and testis.

Q&A

What is Hsd17b7 and what are its primary functions in mouse physiology?

Hsd17b7 (hydroxysteroid 17-beta dehydrogenase 7) is a bifunctional enzyme with dual catalytic activities crucial for cellular metabolism. Initially identified as a prolactin receptor-associated protein (PRAP), it serves two primary functions:

  • As a 17β-hydroxysteroid dehydrogenase that converts estrone to estradiol, playing a role in steroid hormone metabolism

  • As the mammalian 3-ketosteroid reductase in cholesterol biosynthesis, converting zymosterone to zymosterol using NADPH as a cofactor

This enzyme represents the last identified enzyme in the mammalian cholesterol biosynthesis pathway, completing our understanding of this central metabolic process. Expression studies reveal high levels in the corpus luteum, adrenal gland, liver, lung, and thymus, indicating tissue-specific functions related to both steroid metabolism and cholesterol production .

What is the structure and subcellular localization of mouse Hsd17b7?

Mouse Hsd17b7 is a member of the short-chain dehydrogenases/reductases (SDR) protein family. The canonical mouse protein shares significant homology with its human counterpart, which consists of 341 amino acid residues with a molecular mass of approximately 38.2 kDa . The protein's structure includes NADH+/catalytic domains essential for its enzymatic function, which span across multiple exons (with exons 1-4 containing critical functional regions) .

Regarding subcellular localization, immunofluorescence studies reveal that Hsd17b7 displays a particulate perinuclear distribution that does not overlap with mitochondria . More specifically, using green fluorescent protein fusion techniques, researchers have demonstrated that Hsd17b7 localizes to the endoplasmic reticulum (ER), which aligns with its role in cholesterol biosynthesis, as the ER is the primary site of postsqualene cholesterogenesis . This specific localization is crucial for its function within the sterol synthesis pathway.

How does Hsd17b7 participate in cholesterol biosynthesis, and what experimental approaches can verify this function?

Hsd17b7 functions as the 3-ketosteroid reductase in the postsqualene cholesterol biosynthesis pathway. Specifically, it catalyzes the conversion of zymosterone to zymosterol using NADPH as a cofactor—a critical step in cholesterol production . This function can be verified through several experimental approaches:

  • Complementation studies: Expression of mouse Hsd17b7 in Erg27p-deficient yeast strains (lacking endogenous 3-ketosteroid reductase) restores growth on sterol-deficient medium, demonstrating functional conservation of this enzymatic activity .

  • In vitro enzyme assays: Recombinant Hsd17b7 can be tested for its ability to convert zymosterone to zymosterol in reconstituted systems with NADPH, measuring substrate conversion rates through chromatography or mass spectrometry techniques .

  • Knockout models: Complete deletion of Hsd17b7 in mice leads to embryonic lethality, consistent with the essential role of cholesterol in development. Tissue-specific or conditional knockouts can provide more targeted insights into specific developmental or physiological roles .

  • Synexpression analysis: Hsd17b7 is part of a distinct embryonic synexpression group that includes HMG-CoA reductase (the rate-limiting enzyme in cholesterol biosynthesis), supporting its coordinated role in sterol metabolism .

These approaches collectively confirm Hsd17b7's role as the previously missing enzyme in the cholesterol biosynthesis pathway, making it a critical target for investigating inborn errors of cholesterol metabolism.

What is known about the developmental significance of Hsd17b7, and how should researchers design studies to investigate its role in embryogenesis?

Knockout studies have revealed that Hsd17b7 is essential for embryonic development. Homozygous deletion of exons 1-4 (disrupting the NADH+/catalytic domain) results in embryonic lethality, with no viable Hsd17b7-null mice obtained from heterozygous breeding pairs . This finding was unexpected for researchers who initially anticipated fertility defects due to estrogen regulation disruption, suggesting the cholesterol biosynthesis function is critical for development.

When designing studies to investigate Hsd17b7's role in embryogenesis, researchers should consider:

  • Temporal expression analysis: Examine Hsd17b7 expression patterns throughout developmental stages using in situ hybridization or immunohistochemistry to identify critical periods and tissues.

  • Conditional knockout approaches: Generate tissue-specific or temporally regulated knockout models using Cre-loxP systems to bypass embryonic lethality and examine later developmental functions.

  • Rescue experiments: Test whether supplementation with cholesterol or downstream metabolites can rescue developmental defects in Hsd17b7-deficient embryos.

  • Investigation of compensatory mechanisms: Analyze alternative pathways or enzymes that might partially compensate for Hsd17b7 deficiency during specific developmental windows.

  • Correlation with cholesterol-deficiency disorders: Examine tissues specifically affected in human congenital cholesterol-deficiency disorders, as Hsd17b7 is expressed in tissues involved in the pathogenesis of these conditions .

When interpreting results, researchers should carefully distinguish between phenotypes resulting from disrupted cholesterol biosynthesis versus altered steroid hormone metabolism, potentially using selective inhibitors or metabolite supplementation to dissect these distinct functions.

How does Hsd17b7 expression correlate with cancer progression, and what methodologies are optimal for studying its role in oncogenesis?

Current research indicates significant correlations between Hsd17b7 expression and cancer progression, particularly in squamous cell carcinomas (SCCs). Studies comparing transcriptomic profiles reveal Hsd17b7 as the top-ranked differentially expressed gene in both primary keratinocytes and Head/Neck SCCs from individuals of Black African versus Caucasian ancestries . Higher Hsd17b7 expression is strongly associated with poor survival outcomes in head and neck SCC patients, maintaining statistical significance even after adjusting for sex, age, and ancestry in multiple-variable Cox regression analyses .

To optimally study Hsd17b7's role in oncogenesis, researchers should employ:

  • Gain and loss-of-function experiments: Lentivirus-mediated overexpression and gene silencing approaches in primary cells and cancer cell lines to assess immediate impacts on cellular phenotypes (proliferation, differentiation markers, metabolism) .

  • Clonogenic assays: Measure self-renewal and clonogenic potential of cells with modified Hsd17b7 expression. Evidence shows Hsd17b7 overexpression enhances clonogenicity of primary keratinocytes and SCC cell lines from various tissue origins .

  • Xenograft tumor models: Implant cells with modified Hsd17b7 expression in immunodeficient mice to evaluate tumorigenic potential in vivo, measuring tumor formation rates, growth kinetics, and histological characteristics (proliferation markers like Ki67 and differentiation markers) .

  • Metabolic profiling: Assess mitochondrial function, OXPHOS activity, ATP production, and ROS generation in relation to Hsd17b7 expression levels, as research indicates an inverse relationship between Hsd17b7 levels and mitochondrial electron transfer chain activity .

  • Mechanistic pathway analysis: Investigate relationships between Hsd17b7 activity, zymosterol production, and downstream oncogenic signaling cascades to determine precise molecular mechanisms.

These approaches provide complementary insights into how Hsd17b7 influences cancer cell behavior through both metabolic reprogramming and effects on stem cell potential.

What is the relationship between Hsd17b7 expression, ancestry, and cancer susceptibility, and how can researchers control for confounding variables in such studies?

Research has identified striking ancestry-associated differences in Hsd17b7 expression patterns with implications for cancer susceptibility. Primary keratinocytes and Head/Neck SCCs from individuals of Black African ancestry show significantly higher Hsd17b7 expression compared to those from White Caucasian ancestry, correlating with increased oncogenic and self-renewal potential . This expression difference appears linked to ancestry-specific expression quantitative trait loci (eQTLs).

When investigating these relationships, researchers should implement the following controls and considerations:

  • Genomic admixture assessment: Quantify and account for genomic admixture (approximately 20% reported in some studies) that might influence expression patterns and phenotypic outcomes .

  • eQTL analysis: Examine specific eQTLs with differential allele frequencies between populations. Six identified eQTLs show significantly different allele frequencies between Black and White populations (FST > 0.3) with strong linkage disequilibrium (D' > 0.5) .

  • Multi-tissue validation: Verify that identified ancestry-specific eQTLs affect Hsd17b7 expression across relevant tissue types. The GTEX database confirms that these regulatory variants influence expression in multiple tissues including skin and surface epithelia .

  • Socioeconomic and environmental controls: Account for non-genetic factors that might correlate with ancestry and influence cancer risk or gene expression patterns.

  • Mechanistic dissection: Determine whether ancestry-associated expression differences directly impact cellular phenotypes through targeted genetic modifications that normalize expression levels across cell types.

These approaches help distinguish genetic contributions to Hsd17b7 expression differences from environmental or socioeconomic factors, enabling more accurate assessment of how this gene influences cancer susceptibility among different populations.

What are the optimal conditions for producing and purifying active recombinant mouse Hsd17b7, and how should enzymatic activity be validated?

Production and purification of active recombinant mouse Hsd17b7 requires careful attention to several key parameters:

Expression System Selection:

  • Mammalian expression systems (HEK293, CHO) may provide proper folding and post-translational modifications for full enzymatic activity

  • Insect cell systems (Sf9, High Five) offer compromise between mammalian authenticity and higher yields

  • E. coli systems may require additional optimization for soluble expression but can provide higher yields

Purification Strategy:

  • Include affinity tags (His, GST) positioned to avoid interference with the NADH+/catalytic domain

  • Maintain membrane-associated conditions during purification as Hsd17b7 is an ER-localized protein

  • Use detergents carefully selected to maintain enzyme structure while solubilizing the protein

  • Consider protein stabilizers and glycerol to preserve activity during purification

Enzymatic Activity Validation:

  • Dual activity assays to confirm both functions:

    • Estrone to estradiol conversion using NADPH as cofactor

    • Zymosterone to zymosterol conversion using NADPH as cofactor

  • Analytical methods:

    • HPLC or LC-MS to quantify substrate conversion rates

    • Spectrophotometric assays measuring NADPH consumption

    • Radioactive substrate tracing for highly sensitive detection

  • Functional complementation:

    • Expression in Erg27p-deficient yeast strains should restore growth on sterol-deficient medium

    • Rescue experiments in Hsd17b7-deficient mammalian cell lines

The purified protein should be characterized for structural integrity through circular dichroism and thermal stability assays before proceeding to enzymatic characterization or crystallization studies.

What techniques are most effective for studying the interplay between Hsd17b7's dual enzymatic functions, and how can researchers differentiate these activities in complex biological systems?

Studying the dual functionality of Hsd17b7 presents unique challenges that require specialized approaches to differentiate between its roles in steroid metabolism versus cholesterol biosynthesis:

Site-Directed Mutagenesis Approaches:

  • Generate point mutations targeting catalytic residues that differentially affect each function

  • Create chimeric proteins with domains from related enzymes with more selective activities

  • Validate mutants with in vitro assays measuring both enzymatic activities independently

Selective Inhibition Strategies:

  • Develop and apply selective inhibitors that target one catalytic function while sparing the other

  • Use competitive substrates that preferentially engage one catalytic site

  • Perform dose-response studies with inhibitors to identify concentration windows with selective effects

Metabolic Labeling and Tracing:

  • Apply stable isotope-labeled precursors specific to each pathway

  • Track metabolic flux through each pathway using mass spectrometry

  • Analyze compartment-specific metabolism using subcellular fractionation techniques

Genetic Rescue Experiments:

  • In Hsd17b7-deficient systems, introduce mutants with selective activity preservation

  • Supplement specific pathway end-products to determine which function is critical for observed phenotypes

  • Use orthogonal enzymes from other species with more selective activity profiles

Integrative Analysis:

  • Correlate gene expression patterns with metabolite profiles across multiple tissues and conditions

  • Apply systems biology approaches to model the relative contribution of each function

  • Examine protein-protein interactions that may selectively regulate one function over the other

These approaches collectively enable researchers to dissect the relative contributions of Hsd17b7's dual functions to observed phenotypes in different physiological and pathological contexts.

What regulatory mechanisms control Hsd17b7 expression in different tissues, and how do ancestry-specific eQTLs influence its expression patterns?

Hsd17b7 expression is subject to complex tissue-specific regulation involving multiple mechanisms:

Transcriptional Regulation:

  • Promoter analysis reveals Hsd17b7 contains regulatory elements associated with cholesterol biosynthesis genes in both humans and mice

  • Coordinate regulation with other cholesterol biosynthesis genes suggests shared transcription factor binding sites

  • Tissue-specific enhancers likely drive differential expression in adrenal gland, liver, lung, thymus, and corpus luteum

Ancestry-Specific Regulation Through eQTLs:

  • Multiple SNPs in the Hsd17b7 gene show strong association with its expression (FDR < 0.005)

  • Six identified eQTLs demonstrate significantly different allele frequencies between Black and White populations (FST > 0.3)

  • These ancestry-specific variants exhibit strong linkage disequilibrium (D' > 0.5)

  • GTEX database analysis confirms these eQTLs influence Hsd17b7 expression across multiple tissues including skin and surface epithelia

Experimental Approaches to Study Regulation:

  • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding

  • Reporter assays with promoter/enhancer constructs containing different eQTL variants

  • Chromosome conformation capture (3C, 4C, Hi-C) to identify long-range regulatory interactions

  • CRISPR-based epigenome editing to modulate specific regulatory elements

For researchers investigating ancestry-specific expression patterns, allele-specific expression analysis in heterozygous samples can directly quantify cis-regulatory effects, while CRISPR-mediated substitution of specific eQTL variants can establish causality between genetic variation and expression differences.

How does Hsd17b7 expression correlate with cellular metabolic states, and what experimental designs best capture these relationships?

Research indicates significant correlations between Hsd17b7 expression and cellular metabolic states, particularly mitochondrial function and energy metabolism:

Key Metabolic Correlations:

  • Hsd17b7 expression inversely correlates with mitochondrial electron transfer chain activity

  • Higher Hsd17b7 levels associate with decreased ATP and ROS production

  • Transcriptomic analyses show significant correlation between Hsd17b7 expression and genes involved in cellular metabolic processes and mitochondrial compartments

  • Modulation of Hsd17b7 affects OXPHOS activity, with zymosterol (its enzymatic product) potentially mediating this effect

Optimal Experimental Designs:

  • Integrated multi-omics approaches:

    • Correlate transcriptomics, proteomics, and metabolomics data from the same samples

    • Include mitochondrial DNA copy number and proteome analysis

    • Measure key metabolites in both cholesterol and steroid hormone pathways

  • Real-time metabolic profiling:

    • Seahorse XF analysis to measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

    • Live-cell imaging with metabolic sensors for ATP, NADH, and ROS

    • Isotope tracing to track carbon flux through different metabolic pathways

  • Perturbation experiments:

    • Acute versus chronic Hsd17b7 modulation to distinguish direct versus adaptive effects

    • Selective inhibition of specific metabolic pathways to identify dependencies

    • Metabolite supplementation to test rescue of phenotypes

  • Single-cell correlation analyses:

    • Single-cell RNA-seq combined with metabolic profiling

    • Spatial transcriptomics to capture tissue-specific metabolic heterogeneity

    • Trajectory analysis to map metabolic state transitions

These experimental designs collectively enable researchers to establish causal relationships between Hsd17b7 expression, its enzymatic products, and cellular metabolic reprogramming in both physiological and pathological contexts.

Based on Hsd17b7's role in cancer progression, what strategies might researchers pursue for therapeutic targeting, and what experimental models best evaluate efficacy?

Given Hsd17b7's association with enhanced oncogenic potential, self-renewal capacity, and poor clinical outcomes, several therapeutic targeting strategies warrant investigation:

Potential Therapeutic Approaches:

  • Direct enzyme inhibition:

    • Develop small molecule inhibitors targeting the catalytic domain

    • Design competitive antagonists that interact with substrate binding sites

    • Create allosteric modulators that alter protein conformation and function

  • Expression modulation:

    • Identify and target transcription factors regulating Hsd17b7 expression

    • Develop antisense oligonucleotides or siRNAs for post-transcriptional silencing

    • Design epitranscriptomic approaches to modulate mRNA stability or translation

  • Metabolic pathway intervention:

    • Target metabolic vulnerabilities created by high Hsd17b7 expression

    • Develop combination approaches with OXPHOS modulators given the inverse relationship between Hsd17b7 expression and mitochondrial activity

    • Explore synergistic approaches with cholesterol synthesis inhibitors

Optimal Experimental Models for Efficacy Evaluation:

  • In vitro systems:

    • Cancer cell lines with variable endogenous Hsd17b7 expression

    • Primary patient-derived cells that maintain original expression patterns

    • 3D organoid cultures that better recapitulate tumor microenvironment

    • Co-culture systems that include stromal and immune components

  • In vivo models:

    • Patient-derived xenografts (PDXs) maintaining original tumor heterogeneity

    • Genetically engineered mouse models (GEMMs) with tissue-specific Hsd17b7 overexpression

    • Syngeneic models allowing assessment of immune system interactions

    • Metastasis models to evaluate effects on advanced disease progression

  • Efficacy parameters:

    • Primary tumor growth inhibition

    • Markers of cancer stem cell frequency and self-renewal capacity

    • Metabolic reprogramming (OXPHOS activity, ATP production)

    • Tumor differentiation status assessed by markers like keratins 1 and 10

These approaches should particularly focus on cancer types showing ancestry-associated Hsd17b7 expression differences, as these might represent precision medicine opportunities for populations with increased cancer susceptibility.

How can knowledge of Hsd17b7 function inform our understanding of congenital disorders of cholesterol metabolism, and what research models best recapitulate these conditions?

As the last identified enzyme in mammalian cholesterol biosynthesis, Hsd17b7 represents an important candidate gene for previously unexplained congenital disorders of cholesterol metabolism:

Clinical and Developmental Implications:

  • Complete Hsd17b7 deficiency causes embryonic lethality in mice, indicating its essential role in development

  • Hsd17b7 is specifically expressed in tissues involved in the pathogenesis of congenital cholesterol-deficiency disorders

  • As the 3-ketosteroid reductase of cholesterol biosynthesis, Hsd17b7 represents a novel candidate for inborn errors of cholesterol metabolism

  • Partial deficiencies might present with tissue-specific manifestations, particularly in organs highly dependent on cholesterol synthesis

Optimal Research Models:

  • Hypomorphic genetic models:

    • Mouse models with reduced but not absent Hsd17b7 function

    • Conditional knockout models restricting deletion to specific developmental periods

    • CRISPR-engineered models harboring patient-specific mutations

  • Patient-derived systems:

    • Induced pluripotent stem cells (iPSCs) from patients with suspected disorders

    • Differentiation of iPSCs into affected tissue types (neurons, hepatocytes)

    • Organoid models of affected organs to study tissue-specific pathology

  • Developmental timing considerations:

    • Temporally controlled gene expression systems

    • Ex vivo whole embryo culture for short-term developmental studies

    • In utero interventions to assess rescue strategies

Methodological Approaches:

  • Metabolomic profiling:

    • Measure accumulation of zymosterone and depletion of zymosterol

    • Assess global sterol profiles to identify compensatory changes

    • Examine tissue-specific metabolite alterations

  • Developmental phenotyping:

    • Detailed embryological analysis at different developmental stages

    • Tissue-specific assessment of cholesterol content and distribution

    • Evaluation of steroid hormone production and signaling

  • Therapeutic exploration:

    • Dietary cholesterol supplementation and timing requirements

    • Zymosterol replacement strategies

    • Combinatorial approaches addressing both cholesterol and steroid hormone pathways

These approaches would provide valuable insights into both the basic biology of cholesterol metabolism during development and potential therapeutic strategies for related human disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.