Recombinant Mouse 3-ketodihydrosphingosine reductase (Kdsr)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your required tag type during order placement for preferential development.
Synonyms
Kdsr; Fvt1; 3-ketodihydrosphingosine reductase; KDS reductase; 3-dehydrosphinganine reductase; Follicular variant translocation protein 1 homolog; FVT-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-332
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Kdsr
Target Protein Sequence
KPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKDIEKHSINDKQ VVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFEKLMSIN YLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVK PYNVYVTVAYPPDTDTPGLAEENKTKPLETRLISETTAICKPEQVAKQIVKDAIQGNFNS SIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNIVRRCMVQKAKP EVVDKTA
Uniprot No.

Target Background

Function
This recombinant mouse 3-ketodihydrosphingosine reductase (Kdsr) catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
Gene References Into Functions
  1. FVT-1, a mammalian 3-ketodihydrosphingosine reductase, possesses an active site oriented towards the cytosolic face of the endoplasmic reticulum membrane. PMID: 15328338
Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of Kdsr in sphingolipid biosynthesis?

Kdsr (3-ketodihydrosphingosine reductase) catalyzes the reduction of 3-ketodihydrosphingosine (3KDS) to dihydrosphingosine, representing a critical early step in the sphingolipid biosynthetic pathway. This reaction follows the initial condensation of serine and palmitoyl-CoA by the serine palmitoyltransferase (SPT) complex, which produces 3KDS . The Kdsr-mediated reduction is essential for the subsequent production of more complex sphingolipids downstream. The enzyme's active site residues are localized to the cytosolic side of the endoplasmic reticulum membrane, allowing it to interact with its substrate in this specific cellular compartment .

The importance of this reaction extends beyond simply advancing the sphingolipid synthesis pathway. Recent research has revealed that Kdsr plays a crucial detoxification role by clearing the potentially toxic intermediate metabolite 3KDS. Experimental evidence shows that disruption of Kdsr can lead to a 200-fold accumulation of 3KDS, which demonstrates toxic properties in a time- and dose-dependent manner .

How conserved is Kdsr across species, and what implications does this have for mouse models?

Mouse Kdsr demonstrates remarkably high sequence homology with human KDSR, showing 94% antigen sequence identity . This high degree of conservation makes mouse models particularly valuable for investigating Kdsr functions relevant to human health and disease. The structural and functional conservation extends to other vertebrates as well, with zebrafish kdsr also showing high protein homology with human KDSR .

What expression systems are most effective for producing functional recombinant mouse Kdsr?

For producing functional recombinant mouse Kdsr, mammalian expression systems are generally preferred over bacterial systems due to the need for proper protein folding and post-translational modifications. HEK293 or CHO cell lines typically yield recombinant Kdsr with native-like activity and conformation.

When designing expression constructs, researchers should consider including:

  • A cleavable tag (His6 or FLAG) for purification purposes

  • Codon optimization for the host expression system

  • Signal peptides for proper localization to the ER membrane

For validation of expressed Kdsr, enzymatic activity assays measuring the conversion of 3KDS to dihydrosphingosine should be performed. This can be accomplished through LC-MS/MS-based detection of substrate consumption and product formation. Complementation studies in yeast (similar to those performed with bovine FVT1 in Δtsc10 strains) can also confirm functional activity .

What are the most reliable methods for measuring Kdsr enzymatic activity in experimental settings?

The gold standard for measuring Kdsr enzymatic activity involves quantifying the conversion of 3-ketodihydrosphingosine (3KDS) to dihydrosphingosine using liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS). This approach requires:

  • Preparation of microsomes or membrane fractions from cells expressing recombinant Kdsr

  • Incubation with the substrate (3KDS) and cofactor (NADPH)

  • Lipid extraction using chloroform/methanol

  • Analysis by LC-MS/MS to quantify both substrate depletion and product formation

Complementary approaches include:

  • Yeast complementation assays, where mouse Kdsr expression rescues growth defects in Δtsc10 yeast strains (the S. cerevisiae homolog of Kdsr)

  • Isotope labeling studies using [3H]-sphinganine or [13C]-serine to track flux through the sphingolipid pathway

  • Fluorescent substrate analogs that change spectral properties upon reduction

For high-throughput screening applications, researchers can employ ELISA-based detection systems similar to those developed for human KDSR , though these measure protein levels rather than direct enzymatic activity.

How can researchers effectively generate and validate Kdsr knockout or knockdown models?

Generating effective Kdsr knockout or knockdown models requires careful consideration of experimental design due to potential embryonic lethality or severe phenotypes associated with complete Kdsr deficiency. Several approaches are recommended:

For CRISPR-Cas9 knockout models:

  • Design guide RNAs targeting conserved regions of the catalytic domain

  • Include CRISPR-resistant rescue constructs with silent mutations to validate phenotype specificity

  • Consider conditional knockout strategies using Cre-loxP systems for tissue-specific or inducible deletion

For RNAi knockdown approaches:

  • Design multiple siRNA or shRNA constructs targeting different regions of Kdsr mRNA

  • Validate knockdown efficiency by qRT-PCR and western blotting

  • Establish dose-response relationships between knockdown level and phenotype

Validation methods:

  • Molecular validation: Genomic sequencing, qRT-PCR, western blotting

  • Biochemical validation: Measurement of 3KDS accumulation (200-fold increase is expected in complete knockout)

  • Functional validation: Rescue experiments with wild-type Kdsr expression

  • Phenotypic validation: Assessment of cellular morphology changes, ER stress markers, and sphingolipid profiles

When examining knockout phenotypes, researchers should consider both direct effects from Kdsr deficiency and secondary adaptations that may occur through compensatory mechanisms.

What sphingolipid analysis techniques provide the most comprehensive profile for Kdsr functional studies?

For comprehensive sphingolipid profiling in Kdsr functional studies, a multi-platform analytical approach is recommended:

Targeted Lipidomics by LC-MS/MS:

  • Utilize multiple reaction monitoring (MRM) to quantify:

    • 3-ketodihydrosphingosine (substrate)

    • Dihydrosphingosine (immediate product)

    • Sphingosine and sphingosine-1-phosphate

    • Ceramides and downstream complex sphingolipids

Complementary Techniques:

  • Thin-layer chromatography (TLC) for rapid screening

  • Imaging mass spectrometry for tissue distribution analysis

  • Stable isotope labeling to track metabolic flux

Sample Preparation Considerations:

  • Rapid quenching of metabolism is essential (liquid nitrogen)

  • Use internal standards for each major sphingolipid class

  • Consider subcellular fractionation to assess compartment-specific changes

When interpreting results, researchers should examine not only changes in individual sphingolipid species but also alterations in pathway flux and the balance between de novo synthesis and salvage pathways, as Kdsr mutations have been shown to activate compensatory sphingolipid salvage pathways .

How do Kdsr mutations contribute to liver pathologies, and what methods best capture these effects?

Kdsr mutations contribute to liver pathologies through multiple interconnected mechanisms, as demonstrated in zebrafish kdsr mutant models. The I105R kdsr mutation leads to progressive liver disease characterized by:

  • Abnormal sphingolipid metabolism with accumulation of ceramides, sphingosine, and sphingosine-1-phosphate due to compensatory activation of the lysosomal sphingolipid salvage pathway

  • Oxidative stress resulting from elevated mitochondrial β-oxidation

  • Endoplasmic reticulum stress

  • Glutathione depletion, reducing cellular antioxidant capacity

  • Mitochondrial cristae abnormalities and subsequent hepatocellular injury

To effectively capture these effects in mouse models, researchers should employ:

Histological analyses:

  • H&E staining for general liver architecture

  • Oil Red O staining for lipid accumulation/steatosis

  • Trichrome staining for fibrosis

Biochemical assessments:

  • Serum liver enzymes (ALT, AST)

  • Oxidative stress markers (MDA, protein carbonylation)

  • GSH/GSSG ratio measurement

  • ER stress markers (CHOP, BiP, XBP1 splicing)

Molecular analyses:

  • Comprehensive sphingolipid profiling by LC-MS/MS

  • Transcriptomic analysis focusing on lipid metabolism, ER stress, and oxidative stress pathways

  • Mitochondrial function assessment (oxygen consumption, membrane potential)

Given the complexity of liver disease progression, temporal studies capturing early and late changes are essential for understanding disease mechanisms fully.

What are the neural phenotypes associated with Kdsr dysfunction, and how can these be studied in mouse models?

Kdsr dysfunction has been linked to neurological phenotypes, most notably indicated by the association between a missense mutation in the bovine ortholog and spinal muscular atrophy . While the specific neural phenotypes in mouse models remain to be fully characterized, several approaches can effectively study the neurological consequences of Kdsr dysfunction:

Behavioral assessments:

  • Motor function tests (rotarod, grip strength, beam walking)

  • Cognitive assessments (Morris water maze, fear conditioning)

  • Sensory function evaluation

Histological and cellular analyses:

  • Assessment of motor neuron numbers and morphology

  • Neuroinflammation markers (microglia/astrocyte activation)

  • Myelination status evaluation

  • Synaptic density and ultrastructural analysis

Molecular and biochemical approaches:

  • Sphingolipid profiling in different brain regions

  • Regional assessment of 3KDS accumulation

  • ER stress marker expression in neural tissues

  • Mitochondrial function in isolated brain mitochondria

Electrophysiological studies:

  • Ex vivo slice recordings

  • In vivo EEG monitoring

  • Nerve conduction velocity measurements

These approaches should be applied to both constitutive and conditional Kdsr knockout models, with the latter allowing for tissue-specific and temporal control to distinguish between developmental and adult roles of Kdsr in neural function.

How does Kdsr function intersect with cancer biology, and what experimental systems best model these interactions?

Kdsr function intersects with cancer biology through several mechanisms, with recent evidence suggesting it may serve as a potential therapeutic target. Key intersections include:

  • Detoxification of 3KDS, which accumulates to toxic levels in KDSR knockout cancer cells

  • Synergistic effects with palmitate, where increased palmitate availability enhances toxicity in KDSR-deficient cancer cells

  • Activation of ER stress and unfolded protein response pathways upon KDSR disruption

  • Differential sensitivity to KDSR disruption across cancer types

To effectively model these interactions, researchers should consider:

Cell-based systems:

  • CRISPR knockout of Kdsr in mouse cancer cell lines

  • Inducible knockdown systems to study temporal effects

  • Rescue experiments with wild-type and mutant Kdsr

  • Co-culture systems to evaluate tumor-stroma interactions

In vivo models:

  • Xenograft models with Kdsr-deficient cancer cells

  • High-fat diet studies to modulate palmitate availability and enhance Kdsr knockout effects

  • Patient-derived xenograft models

Experimental approaches:

  • Combined metabolic and transcriptomic profiling

  • Fluorescent reporters for ER stress pathway activation

  • In vivo imaging to monitor tumor growth and response to treatments

  • Drug combination studies targeting both Kdsr and sphingolipid salvage pathways

The experimental data suggests that targeting Kdsr could be particularly effective in specific cancer contexts, especially when combined with dietary interventions or metabolic modulators that increase 3KDS production .

How do post-translational modifications regulate Kdsr activity, and what methods can detect these modifications?

While specific information on post-translational modifications (PTMs) of mouse Kdsr is limited in the provided search results, research on related enzymes in the sphingolipid pathway suggests several potential regulatory modifications. Advanced methods to study these include:

Identification of PTM sites:

  • Mass spectrometry-based phosphoproteomics, glycoproteomics, and ubiquitylomics

  • Site-directed mutagenesis of predicted modification sites

  • Western blotting with modification-specific antibodies

Functional impact assessment:

  • In vitro enzymatic assays comparing modified and unmodified forms

  • Cellular localization studies using fluorescently tagged Kdsr variants

  • Protein stability assessments following inducement or prevention of specific modifications

Regulatory pathway analysis:

  • Pharmacological modulators of suspected regulatory kinases/phosphatases

  • Stress condition responses (ER stress, oxidative stress)

  • Nutrient availability effects on modification patterns

These approaches can help elucidate how Kdsr activity is dynamically regulated in response to changing cellular conditions, potentially revealing new therapeutic intervention points.

What interacting proteins modulate Kdsr function, and how can protein-protein interactions be mapped?

Mapping the Kdsr interactome is essential for understanding its functional regulation and cellular integration. Several complementary approaches can identify and characterize protein-protein interactions:

Discovery methods:

  • Affinity purification coupled with mass spectrometry (AP-MS)

  • Proximity labeling techniques (BioID, APEX) particularly useful for membrane proteins like Kdsr

  • Yeast two-hybrid screening with Kdsr domains

  • Co-immunoprecipitation followed by mass spectrometry

Validation approaches:

  • Reciprocal co-immunoprecipitation of candidate interactors

  • Bimolecular fluorescence complementation (BiFC)

  • Förster resonance energy transfer (FRET)

  • Mammalian two-hybrid assays

Functional characterization:

  • siRNA knockdown of interacting partners with assessment of Kdsr activity

  • Domain mapping to identify interaction interfaces

  • Subcellular co-localization studies

Given Kdsr's localization to the ER membrane, particular attention should be paid to other ER-resident proteins, components of the sphingolipid metabolic pathway, and potential quality control machinery that might influence Kdsr stability and function.

How does Kdsr function integrate with broader cellular stress response pathways?

Kdsr function is intricately connected to cellular stress response pathways, particularly ER stress and oxidative stress. Understanding these connections requires integrated analytical approaches:

ER stress connections:

  • Analysis of Kdsr knockout effects on ER stress markers (BiP, CHOP, XBP1 splicing)

  • Assessment of unfolded protein response activation in Kdsr-deficient cells

  • Evaluation of whether ER stress inducers (tunicamycin, thapsigargin) modulate Kdsr expression or activity

Oxidative stress interactions:

  • Measurement of ROS levels and oxidized/reduced glutathione ratios in Kdsr mutants

  • Assessment of mitochondrial function parameters (membrane potential, respiration rate)

  • Examination of how antioxidant treatments (N-acetylcysteine) affect Kdsr mutant phenotypes

Integrated pathway analysis:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Time-course studies to dissect primary from secondary effects

  • Genetic interaction studies with key components of stress response pathways

Research in zebrafish kdsr mutants has shown that GSH depletion occurs despite upregulation of enzymes responsible for GSH synthesis and reduction , highlighting the complex interplay between Kdsr function and cellular redox homeostasis that requires comprehensive analytical approaches to fully understand.

What are the most common pitfalls in Kdsr activity assays, and how can researchers overcome them?

Researchers frequently encounter several challenges when conducting Kdsr activity assays:

Challenge 1: Substrate availability and stability

  • 3-ketodihydrosphingosine (3KDS) is not commercially available and is unstable

  • Solution: Synthesize 3KDS immediately before use or utilize stable analogs that maintain native substrate properties

Challenge 2: Membrane protein solubilization

  • Kdsr is an ER membrane protein that loses activity when improperly solubilized

  • Solution: Use mild detergents (DDM, CHAPS) or prepare microsomes that preserve the native membrane environment

Challenge 3: Cofactor requirements

  • Ensuring sufficient NADPH availability throughout the reaction

  • Solution: Include an NADPH regenerating system (glucose-6-phosphate/G6PDH)

Challenge 4: Product detection sensitivity

  • Dihydrosphingosine can be difficult to detect at low concentrations

  • Solution: Employ derivatization strategies (o-phthalaldehyde) to enhance detection sensitivity or use highly sensitive LC-MS/MS methods

Challenge 5: Distinguishing enzymatic from non-enzymatic conversion

  • Solution: Always include proper controls (heat-inactivated enzyme, no-substrate controls)

By addressing these common pitfalls, researchers can develop robust and reproducible Kdsr activity assays that accurately reflect the enzyme's function.

How can researchers distinguish between primary effects of Kdsr disruption and secondary compensatory responses?

Distinguishing primary effects from secondary compensatory responses represents a significant challenge in Kdsr research. Several strategies can help researchers make this distinction:

Temporal analysis approaches:

  • Time-course studies capturing very early changes (hours) following acute Kdsr inactivation

  • Inducible knockout/knockdown systems to control the timing of Kdsr disruption

  • Pulse-chase metabolic labeling to track immediate metabolic consequences

Genetic manipulation strategies:

  • Partial vs. complete Kdsr inhibition to identify dose-dependent effects

  • Combined knockout of Kdsr with suspected compensatory pathways

  • Expression of catalytically inactive Kdsr mutants vs. complete protein absence

Pathway manipulation approaches:

  • Pharmacological inhibition of suspected compensatory pathways

  • Substrate availability modulation (e.g., palmitate supplementation)

  • Combined inhibition of de novo synthesis and salvage pathways

Multi-omics integration:

  • Combined transcriptomic, proteomic, and metabolomic analyses to build comprehensive network models

  • Computational modeling to predict and test compensatory pathway activation

For example, research has shown that Kdsr disruption leads to activation of the lysosomal sphingolipid salvage pathway as a compensatory mechanism . Using approaches that block this pathway while simultaneously disrupting Kdsr can help distinguish primary from compensatory effects.

What strategies can address the embryonic lethality often associated with complete Kdsr knockout?

Complete knockout of Kdsr likely causes embryonic lethality due to the essential nature of sphingolipid metabolism. Researchers can employ several strategies to circumvent this limitation:

Conditional knockout approaches:

  • Tissue-specific Cre-loxP systems targeting Kdsr in specific cell types

  • Temporal control using tamoxifen-inducible CreERT2 systems for postnatal deletion

  • Dual recombinase systems (Cre/Flp) for more precise spatiotemporal control

Hypomorphic allele generation:

  • Introduction of mutations that reduce but don't eliminate activity

  • Gene-trap approaches with partial splicing capability

  • Targeted disruption of regulatory elements rather than coding regions

Partial inhibition strategies:

  • Titrated RNAi approaches (inducible shRNA, siRNA)

  • Small molecule inhibitors with adjustable dosing

  • Dominant-negative mutant expression

Alternative model systems:

  • Zebrafish models, which have shown viability with kdsr mutations (e.g., I105R)

  • Tissue-specific organoids derived from Kdsr floxed mice

  • Cell culture models with acute CRISPR knockout followed by immediate analysis

These approaches allow researchers to study Kdsr function while avoiding complete developmental failure, facilitating investigation of tissue-specific roles and adult functions of the enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.