Recombinant Mouse 4-hydroxybenzoate polyprenyltransferase, mitochondrial (Coq2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mouse Coq2 is produced in heterologous expression systems with the following specifications:

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, or mammalian cells .
Purity≥85% as determined by SDS-PAGE .
ApplicationsEnzyme activity assays, antibody production, and functional studies .

Functional Complementation Studies

  • Human COQ2 homologs expressed in yeast Coq2 null mutants restore CoQ biosynthesis, albeit at lower efficiency compared to native yeast enzymes . This highlights evolutionary conservation of Coq2’s catalytic role.

Role in CoQ Deficiency Models

  • While direct mouse Coq2 knockout models are not detailed in the provided sources, studies on related CoQ biosynthesis genes (e.g., Coq7, Coq9) demonstrate embryonic lethality and mitochondrial dysfunction when CoQ synthesis is disrupted . These findings underscore Coq2’s indispensability in embryonic development and energy metabolism.

Enzyme Kinetics and Substrate Specificity

  • Mouse Coq2 preferentially utilizes decaprenyl or nonaprenyl diphosphates for PHB prenylation, producing CoQ isoforms with 9–10 isoprene units .

Comparative Insights Across Species

  • Human vs. Mouse: Human COQ2 shares 77% sequence identity with mouse Coq2 , enabling cross-species functional studies.

  • Parasitic Helminths: Alternative splicing of coq-2 in Caenorhabditis elegans regulates rhodoquinone synthesis under anaerobic conditions , though this mechanism is absent in mammals.

Pathophysiological Implications

Mutations in COQ2 homologs are linked to primary CoQ deficiencies, manifesting as encephalopathy, myopathy, or renal dysfunction . Recombinant mouse Coq2 provides a tool to investigate these disorders and screen therapeutic compounds like ubiquinone analogs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Coq2; 4-hydroxybenzoate polyprenyltransferase, mitochondrial; 4-HB polyprenyltransferase; Para-hydroxybenzoate--polyprenyltransferase; PHB:PPT; PHB:polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-374
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Coq2
Target Protein Sequence
AGVPGARDRRAPAPGTQRGRALSLSAAAVVNSAPRPLQPYLRLMRLDKPIGTWLLYLPCT WSIGLAADPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDRDFDKKVTRTANRPIAAGDI STFQSFVFLGGQLTLALGVLLCLNYYSIAMGAASLLLVVTYPLVKRITFWPQLALGLTFN WGALLGWSAVKGSCDPAVCLPLYFSGVMWTLIYDTIYAHQDKKDDALIGLKSTALLFQEN TRQWLSGFGVAMVAALSLAGANNGQTVPYYAAVAAVGAHLAHQIYTVDIHRAEDCWDKFT SNRTVGMLLFLGIVLGNLCKEKTEEAKDAEAVRVGSEQTS
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein; Matrix side.

Q&A

What is the primary function of mouse 4-hydroxybenzoate polyprenyltransferase (Coq2)?

Mouse 4-hydroxybenzoate polyprenyltransferase (Coq2) is an enzyme that catalyzes a critical reaction in the ubiquinone (Coenzyme Q) biosynthesis pathway. Specifically, Coq2 transfers a polyprenyl group from polyprenyl diphosphate to 4-hydroxybenzoate, forming 4-hydroxy-3-polyprenylbenzoate and releasing diphosphate as a byproduct . This enzymatic step represents one of the early and essential reactions in the multi-step process of ubiquinone synthesis. The enzyme belongs to the transferase family, specifically those that transfer aryl or alkyl groups other than methyl groups . In mouse mitochondria, Coq2 plays a fundamental role in ensuring adequate coenzyme Q production, which is critical for electron transport in the respiratory chain and functions as an important lipid-soluble antioxidant .

How is mouse Coq2 structurally different from human COQ2?

The central cavity where substrate binding occurs shows some variations between species, particularly in residues that interact with the polyprenyl tail. Human COQ2 contains specific residues in the binding pocket that are mutated in patients with primary CoQ deficiency, whereas the mouse ortholog may have slightly different arrangements in these regions . Multiple sequence alignment analyses reveal conservation of catalytic residues across species, but variations in peripheral regions that may influence substrate specificity or membrane interactions. These structural differences must be considered when using mouse models to study human COQ2-related diseases or when designing species-specific inhibitors or activators .

What experimental systems are available for studying recombinant mouse Coq2?

Several experimental systems have been developed to study recombinant mouse Coq2, each with specific advantages for different research questions:

  • Yeast expression systems: Similar to human COQ2 studies, mouse Coq2 can be expressed in yeast strains deficient in their native COQ2 gene. This complementation system allows for functional analysis in a eukaryotic environment . The procedure involves PCR amplification of the mouse Coq2 gene, cloning into vectors like pYES2.1, and transformation into appropriate yeast strains, followed by selection on SD/-ura plates and functional assessment through growth complementation in YPG media .

  • Bacterial expression systems: E. coli-based expression can be utilized for producing large quantities of recombinant protein for biochemical characterization, though membrane integration may require specialized strains.

  • Mammalian cell culture models: Mouse cell lines with CRISPR-mediated Coq2 knockouts can be complemented with recombinant Coq2 variants to study enzyme function in a native cellular environment.

  • In vitro enzymatic assays: Purified recombinant mouse Coq2 can be incorporated into liposomes or nanodiscs to study the enzyme's kinetics and substrate specificity outside cellular contexts.

For optimal results, researchers should isolate mitochondrial fractions post-expression using differential centrifugation techniques and verify protein expression through Western blotting with appropriate antibodies .

What structural insights have AlphaFold predictions revealed about mouse Coq2 substrate binding?

AlphaFold structural predictions have provided significant insights into mouse Coq2 substrate binding mechanisms, despite the absence of experimentally determined crystal structures. Structural analysis reveals that Coq2 contains a central cavity likely responsible for binding both 4-hydroxybenzoate (PHB) and polyprenyl diphosphate substrates .

The binding site analysis, performed using homology-based approaches and the ProBiS server, has identified several key features:

  • The enzyme contains a cavity with both hydrophilic and hydrophobic regions that accommodate the polar head of 4-hydroxybenzoate and the hydrophobic polyprenyl tail, respectively .

  • Specific residues located within the central cavity and matrix loops appear to be involved in substrate interactions. Some of these residues align with positions that are mutated in primary CoQ deficiency patients, suggesting their functional importance .

  • The polyprenyl binding channel appears to be lined with predominantly hydrophobic residues that create a tunnel extending from the active site toward the membrane interior, likely facilitating the positioning of the long isoprenoid tail .

  • The diphosphate moiety of the polyprenyl substrate likely interacts with positively charged residues near the matrix side of the protein, stabilizing the binding through ionic interactions .

These structural insights provide a foundation for understanding the catalytic mechanism and for rational design of experiments to probe substrate specificity and enzyme regulation.

How do pathogenic mutations in mouse Coq2 affect enzyme activity and what are the implications for modeling human disease?

Pathogenic mutations in mouse Coq2 profoundly impact enzyme activity through various molecular mechanisms, providing valuable insights for modeling human CoQ deficiency. Structure-function analyses based on AlphaFold predictions have revealed that mutations can affect enzyme function through multiple pathways:

  • Disruption of substrate binding pockets: Mutations within the central cavity can alter the geometry or electrostatic properties of substrate binding sites, reducing affinity for either 4-hydroxybenzoate or polyprenyl diphosphate .

  • Destabilization of protein structure: Some mutations affect residues involved in maintaining the tertiary structure, potentially leading to protein misfolding, aggregation, or premature degradation .

  • Alteration of membrane integration: Mutations in transmembrane domains can disrupt proper localization to the mitochondrial membrane, preventing the enzyme from accessing its substrates .

  • Interference with catalytic mechanism: Substitutions near catalytic residues can alter the reaction kinetics even when substrate binding remains intact .

For modeling human disease, these findings suggest that:

  • Mouse models carrying equivalent mutations to human pathogenic variants can recapitulate biochemical defects

  • Careful mapping of human mutations onto the mouse protein structure is essential due to subtle sequence differences

  • Some mutations may have species-specific effects due to differences in mitochondrial environment or protein stability

When designing mouse models, researchers should consider introducing mutations with demonstrated functional consequences and validate their impact through enzymatic assays measuring prenylation of 4-hydroxybenzoate .

What are the current challenges in producing high-quality recombinant mouse Coq2 for structural studies?

Producing high-quality recombinant mouse Coq2 for structural studies presents several significant challenges that researchers must overcome:

  • Membrane protein expression and purification: As a mitochondrial membrane protein, Coq2 contains multiple transmembrane domains that make heterologous expression and purification difficult. Standard protocols often result in protein aggregation or misfolding when the protein is removed from the membrane environment .

  • Maintaining native conformation: Preserving the native conformation during purification requires careful selection of detergents or lipid nanodiscs that mimic the mitochondrial membrane environment without disrupting protein structure .

  • Low expression yields: Membrane proteins typically express at lower levels than soluble proteins, necessitating optimization of expression systems. While yeast systems have been successfully used for functional studies , they may not produce sufficient quantities for crystallography.

  • Protein stability issues: The enzyme may exhibit reduced stability outside its native environment, complicating crystallization attempts or cryo-EM sample preparation.

  • Post-translational modifications: Ensuring proper post-translational modifications that might be essential for activity requires eukaryotic expression systems rather than bacterial ones .

To address these challenges, researchers have employed strategies such as:

  • Using specialized expression vectors with inducible promoters

  • Incorporating fusion tags to enhance solubility and facilitate purification

  • Employing zymolase treatment for yeast cell wall digestion prior to protein extraction

  • Optimizing detergent screening for membrane protein solubilization

  • Exploring lipid nanodiscs for maintaining a native-like membrane environment

Despite these approaches, the lack of an experimental 3D structure to date highlights the persistent difficulties in this area .

What is the optimal protocol for functional expression of recombinant mouse Coq2 in yeast systems?

The optimal protocol for functional expression of recombinant mouse Coq2 in yeast systems involves several critical steps:

  • Vector construction and cloning:

    • Amplify the mouse Coq2 gene using high-fidelity DNA polymerase (such as Pfu-turbo) with 5% DMSO to reduce secondary structure formation

    • Use primers that incorporate appropriate restriction sites or sequences compatible with TOPO TA cloning for insertion into pYES2.1 or similar yeast expression vectors

    • Purify the PCR product (~1.2-1.3 kb) by gel electrophoresis before ligation or TOPO cloning

  • Yeast strain selection and transformation:

    • Choose a Coq2-deficient yeast strain (preferably with Rho+ genotype) to allow for complementation testing

    • Grow the selected strain to stationary phase in YPD medium before making cells competent for transformation

    • Transform with the recombinant plasmid according to standard protocols (e.g., lithium acetate method)

    • Select transformants on SD/-ura plates to isolate colonies carrying the expression vector

  • Expression induction and verification:

    • Culture isolated colonies in SD-ura liquid medium for 30 hours at 30°C with continuous shaking (250 rpm)

    • Induce expression by transferring to YPGal medium at A600=0.1 and continuing culture for an additional 20 hours

    • Verify functional complementation through growth assessment on YPG medium

  • Spheroplast preparation for protein extraction:

    • Harvest cells by centrifugation at 1500g for 10 minutes

    • Resuspend in S-buffer (10 mM Tris/HCl, pH 7.4, 1 M sorbitol) containing zymolase (3 mg per 4 ml buffer)

    • Incubate at 30°C for 30 minutes with gentle shaking to digest cell walls

    • Collect spheroplasts by centrifugation at 1500g

This protocol has been demonstrated to yield functional expression of Coq2, allowing for both complementation studies and subsequent biochemical characterization of the enzyme activity .

How can researchers effectively measure mouse Coq2 enzymatic activity in vitro?

Researchers can effectively measure mouse Coq2 enzymatic activity in vitro through several complementary approaches:

  • Radiometric assay using labeled substrates:

    • Incubate purified Coq2 or mitochondrial preparations with [14C]-labeled 4-hydroxybenzoate and unlabeled polyprenyl diphosphate

    • Extract reaction products using organic solvents (hexane:ethanol mixture)

    • Separate products by thin-layer chromatography (TLC)

    • Quantify radioactive product formation by scintillation counting or autoradiography

    • Calculate enzyme activity based on the conversion rate of substrate to product

  • HPLC-based activity assay:

    • Set up reactions containing purified enzyme, 4-hydroxybenzoate, polyprenyl diphosphate, and appropriate buffers with divalent cations (typically Mg2+)

    • Incubate at 30-37°C for defined time periods

    • Terminate reactions with methanol or acetonitrile

    • Analyze reaction products by reverse-phase HPLC with UV detection at 280 nm

    • Quantify product formation using calibration curves with authentic standards

  • Coupled spectrophotometric assay:

    • Design assay where diphosphate release is coupled to NADH oxidation through auxiliary enzymes

    • Monitor decrease in absorbance at 340 nm to indirectly measure Coq2 activity

    • Calculate reaction rates from the linear portion of the absorbance curve

For optimal results, the assay conditions should include:

  • pH 7.4-8.0 buffer (typically Tris-HCl or HEPES)

  • 5-10 mM MgCl2 as a cofactor

  • 0.05-0.1% detergent (e.g., Triton X-100) to maintain enzyme solubility

  • Temperature control at 30-37°C

  • Substrate concentrations spanning the Km values for kinetic analyses

To determine kinetic parameters, researchers should vary substrate concentrations and analyze data using Michaelis-Menten or Lineweaver-Burk plots to establish Km values for both substrates and the Vmax of the enzyme .

What are the best approaches for studying Coq2 protein-protein interactions within the CoQ biosynthetic complex?

The study of Coq2 protein-protein interactions within the CoQ biosynthetic complex requires specialized approaches due to the membrane-associated nature of this multiprotein complex. The following methodologies offer complementary insights:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against mouse Coq2 or use epitope-tagged recombinant versions

    • Solubilize mitochondrial membranes using mild detergents (digitonin or DDM)

    • Perform pull-down experiments to identify interacting partners

    • Analyze by Western blotting for known CoQ biosynthetic proteins or mass spectrometry for unbiased discovery

    • Include appropriate controls with non-specific antibodies and Coq2-deficient samples

  • Proximity-dependent labeling:

    • Create fusion proteins with BioID or APEX2 attached to Coq2

    • Express in mouse cell lines or tissues

    • Activate the labeling enzyme to biotinylate proximal proteins

    • Purify biotinylated proteins using streptavidin capture

    • Identify interaction partners through mass spectrometry analysis

  • Fluorescence resonance energy transfer (FRET):

    • Generate fluorescent protein fusions (e.g., Coq2-CFP and other Coq proteins fused to YFP)

    • Express in appropriate cell lines and localize to mitochondria

    • Measure FRET signals to detect protein-protein proximity

    • Use acceptor photobleaching or fluorescence lifetime imaging for quantification

  • Yeast two-hybrid membrane system:

    • Use split-ubiquitin yeast two-hybrid system designed for membrane proteins

    • Create fusion constructs with Coq2 and potential interaction partners

    • Screen for positive interactions through reporter gene activation

    • Validate primary hits using alternative methods

  • Cross-linking mass spectrometry:

    • Treat isolated mitochondria or purified complexes with MS-compatible cross-linkers

    • Digest proteins and identify cross-linked peptides by specialized MS approaches

    • Reconstruct interaction interfaces from identified cross-links

    • Model spatial arrangement of proteins within the complex

Each method has specific advantages, and combining multiple approaches provides more robust evidence for biological interactions. When interpreting results, researchers should consider that some interactions may be transient or dependent on specific cellular conditions such as respiratory state or coenzyme Q deficiency .

What structural features of mouse Coq2 are critical for substrate specificity and catalytic activity?

Several structural features of mouse Coq2 are crucial for its substrate specificity and catalytic activity, as revealed by homology modeling and AlphaFold structure prediction analyses:

  • Central catalytic cavity:

    • The enzyme contains a central cavity that accommodates both substrates, with specialized regions for binding the aromatic ring of 4-hydroxybenzoate and the polyprenyl chain

    • This cavity is lined with residues that create a microenvironment favorable for the prenylation reaction

  • Substrate binding residues:

    • Specific residues within the central cavity directly interact with 4-hydroxybenzoate, positioning it for prenylation

    • Residues that coordinate with the diphosphate group of the polyprenyl substrate, typically positively charged amino acids, are essential for proper substrate orientation

    • Hydrophobic amino acids line the channel that accommodates the polyprenyl tail, influencing the chain-length specificity of the enzyme

  • Transmembrane domains:

    • The transmembrane helices anchor the protein in the mitochondrial membrane, with specific orientations that allow access of substrates from both the membrane and matrix sides

    • The arrangement of these helices creates a lateral opening for the polyprenyl substrate to enter from the membrane phase

  • Matrix loops:

    • Exposed loops on the matrix side contain residues involved in 4-hydroxybenzoate binding and likely contribute to the initial stages of substrate recognition

    • These regions may also be involved in interactions with other proteins in the CoQ biosynthetic complex

  • Conserved motifs:

    • Sequence analysis has identified highly conserved motifs across species that are critical for catalytic function

    • These include the prenyl-binding region and the catalytic site for the condensation reaction

These structural features collectively determine the enzyme's ability to bind its specific substrates and catalyze the prenylation reaction. Mutations in these regions typically result in reduced enzymatic activity and can lead to coenzyme Q deficiency when they occur in humans .

How does the AlphaFold predicted structure of mouse Coq2 compare with experimental data on enzyme function?

The AlphaFold predicted structure of mouse Coq2 shows significant concordance with experimental data on enzyme function, providing a valuable structural framework for interpreting biochemical findings. This comparison reveals several important insights:

  • Structure-function correlations:

    • The AlphaFold model identifies a central cavity consistent with experimental evidence of a binding site accommodating both 4-hydroxybenzoate and polyprenyl diphosphate substrates

    • The predicted transmembrane topology aligns with experimental data on membrane integration and orientation in the mitochondrial inner membrane

    • Conserved residues identified through multiple sequence alignment (MSA) cluster in regions predicted to be functionally important in the AlphaFold model

  • Mutational analysis validation:

    • Known pathogenic mutations map to structurally significant regions in the AlphaFold model, such as substrate binding sites or protein stability cores

    • The structural impacts predicted for these mutations (using tools like ColabFold) align with observed decreases in enzyme activity from experimental studies

    • The model correctly predicts that mutations in the substrate binding pocket would have more severe effects than those in peripheral regions

  • Substrate specificity predictions:

    • The hydrophobic channel dimensions in the AlphaFold model correlate with experimental data on chain-length specificity for different prenyl donors

    • The positioning of aromatic residues predicted to interact with 4-hydroxybenzoate corresponds to experimental findings on substrate analog binding

  • Limitations and discrepancies:

    • Some dynamic regions of the protein show lower prediction confidence in AlphaFold (lower pLDDT scores), which may explain certain experimental observations not fully captured by the static model

    • The exact configuration of bound substrates may differ slightly from what is predicted based on homology with related enzymes

    • Protein-protein interactions with other components of the CoQ biosynthetic complex are not captured in the single-protein AlphaFold model

This comparison underscores the value of computational structure prediction in guiding experimental research on enzymes like Coq2, particularly when experimental structural determination is challenging due to membrane protein properties .

What techniques can be used to investigate the membrane topology and integration of mouse Coq2?

Investigating the membrane topology and integration of mouse Coq2 requires specialized techniques designed for membrane proteins. The following methodologies provide complementary information about how this enzyme is oriented and embedded within the mitochondrial membrane:

The integration of data from these complementary approaches provides a comprehensive view of how mouse Coq2 is positioned within the mitochondrial membrane, including which domains interface with the lipid bilayer, which are exposed to aqueous environments, and how substrate access channels are oriented relative to the membrane .

How do mouse models of Coq2 dysfunction contribute to understanding human CoQ deficiency syndromes?

Mouse models of Coq2 dysfunction have provided invaluable insights into human CoQ deficiency syndromes through several key contributions:

  • Pathophysiological mechanisms:

    • Mouse models with targeted Coq2 mutations have revealed tissue-specific consequences of CoQ deficiency, particularly in high-energy demanding tissues like brain, kidney, and muscle

    • These models demonstrate how Coq2 dysfunction leads to mitochondrial respiratory chain defects, increased reactive oxygen species production, and cellular energy deficits

    • The progressive nature of pathology in these models mirrors the often age-dependent manifestation of symptoms in human patients

  • Genotype-phenotype correlations:

    • Mice carrying mutations equivalent to human pathogenic variants show varying severity based on mutation location in the protein structure

    • Mutations affecting the substrate binding pocket or catalytic residues produce more severe phenotypes than those in peripheral structural regions

    • Compound heterozygous and homozygous models help elucidate the effects of different mutational combinations seen in human patients

  • Tissue-specific vulnerabilities:

    • Mouse models reveal why certain tissues are particularly vulnerable to Coq2 dysfunction

    • Kidney pathology in mice with Coq2 mutations recapitulates the nephropathy seen in many human CoQ deficiency patients

    • Neurodegenerative changes in mouse models provide insights into the encephalopathy observed in severe human cases

  • Therapeutic implications:

    • Mouse models allow testing of CoQ10 supplementation efficacy under controlled conditions

    • Studies in these models have shown that early intervention is more effective than treatment after symptom onset

    • Alternative therapeutic approaches, such as bypassing the prenylation step with analogs, can be evaluated in these models

  • Biomarker identification:

    • Mouse models facilitate the discovery and validation of biomarkers for diagnosing and monitoring CoQ deficiency

    • Metabolomic changes identified in these models provide potential diagnostic markers for human patients

These contributions collectively enhance our understanding of how Coq2 mutations lead to disease manifestations in humans and provide platforms for developing and testing therapeutic interventions for primary CoQ deficiency syndromes .

What therapeutic strategies target Coq2 function for treating mitochondrial disorders?

Several therapeutic strategies targeting Coq2 function show promise for treating mitochondrial disorders associated with coenzyme Q deficiency:

  • Direct CoQ10 supplementation:

    • Oral ubiquinone (CoQ10) supplementation bypasses the enzymatic defect by providing the end product

    • Various formulations with enhanced bioavailability (ubiquinol, water-soluble CoQ10, nanoparticle delivery) improve tissue uptake

    • Dosing regimens typically range from 5-30 mg/kg/day depending on disease severity

    • Most effective when initiated early, before irreversible tissue damage occurs

  • Substrate modification approaches:

    • Providing modified precursors that can be utilized by partially functional Coq2 enzymes

    • 4-hydroxybenzoate analogs with enhanced binding properties for mutated Coq2

    • These may be effective for specific mutations that alter substrate binding but retain catalytic capacity

  • Gene therapy strategies:

    • Delivery of functional Coq2 gene using adeno-associated virus (AAV) vectors

    • Tissue-specific promoters to target the most affected tissues

    • CRISPR/Cas9-mediated correction of specific mutations in patient-derived cells

    • These approaches address the root cause but face delivery challenges for mitochondrial targeting

  • Enzyme replacement or supplementation:

    • Development of recombinant Coq2 protein with modifications for mitochondrial targeting

    • Nanoparticle-based delivery systems to facilitate cellular uptake and mitochondrial localization

    • This approach remains experimental but offers potential for direct enzyme replacement

  • Pharmacological chaperones:

    • Small molecules designed to stabilize mutant Coq2 proteins and enhance residual activity

    • Structure-based drug design utilizing AlphaFold-predicted models to identify binding sites

    • Most applicable to mutations causing protein misfolding rather than those affecting catalytic residues

  • Metabolic bypassing strategies:

    • Alternative electron carriers that can substitute for CoQ in the respiratory chain

    • Idebenone and other short-chain quinone analogs that can enter mitochondria independently

    • These compounds provide partial functional replacement but may not address all CoQ functions

Each strategy has distinct advantages and limitations, with effectiveness likely dependent on the specific mutation and disease severity. Combination approaches may offer synergistic benefits for patients with primary CoQ deficiency due to Coq2 dysfunction .

How can structural insights from mouse Coq2 inform drug discovery efforts for CoQ-related disorders?

Structural insights from mouse Coq2 models are transforming drug discovery efforts for CoQ-related disorders through several innovative approaches:

  • Structure-based design of Coq2 activators:

    • The AlphaFold-predicted structure reveals potential allosteric sites where small molecules could enhance enzyme activity

    • Virtual screening campaigns can identify compounds that bind these sites and stabilize active conformations

    • Molecular dynamics simulations using the structural model help predict how activators might affect enzyme dynamics

    • These activators could boost residual activity in patients with hypomorphic Coq2 mutations

  • Pharmacological chaperone development:

    • Structural analysis of mutation sites identifies how specific variants disrupt protein folding or stability

    • High-throughput screens can be designed to find molecules that bind mutant Coq2 and promote proper folding

    • The mouse structural model allows rational design of compounds that interact with specific mutation sites

    • Candidates can be tested in cell-based assays using patient-derived cells expressing equivalent mouse mutations

  • Substrate analog optimization:

    • The substrate binding pocket geometry from structural models guides the design of modified 4-hydroxybenzoate analogs

    • These analogs can be optimized for enhanced binding to mutant enzymes

    • Structure-activity relationship studies inform which modifications improve interaction with specific mutant forms

    • The mouse model allows in vivo testing of promising analogs before human clinical trials

  • Prenyl transferase inhibitor design:

    • For research purposes, selective inhibitors help elucidate Coq2 function

    • The polyprenyl binding channel structure informs design of compounds that compete with natural substrates

    • These tools advance understanding of enzyme mechanism and regulation

  • Targeted protein degradation approaches:

    • For dominant negative mutations, proteolysis-targeting chimeras (PROTACs) could selectively remove mutant protein

    • Structural information identifies optimal attachment points for degradation-inducing moieties

    • This strategy might be effective when mutant protein interferes with wild-type function

The table below summarizes how structural features of mouse Coq2 inform different drug discovery approaches:

Structural FeatureDrug Discovery ApplicationPotential Therapeutic Outcome
Central cavityDesign of substrate analogsEnhanced utilization of modified substrates
Allosteric sitesDevelopment of enzyme activatorsIncreased activity of hypomorphic variants
Mutation-induced structural changesPharmacological chaperone designStabilization of mutant protein conformations
Protein-membrane interfaceMembrane-targeted delivery systemsImproved localization of therapeutic agents
Polyprenyl binding channelOptimization of CoQ analogsBetter penetration and utilization of synthetic CoQ

These structure-informed approaches significantly expand the therapeutic landscape beyond conventional CoQ supplementation strategies, offering potential for personalized therapies based on specific Coq2 mutations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.