Recombinant Mouse 5-hydroxytryptamine receptor 1B (Htr1b)

Shipped with Ice Packs
In Stock

Description

Key Features:

ParameterDetailsSource
Amino Acid Length386 residues (mouse)
Sequence Identity~86% with human HTR1B, ~95% with zebrafish HTR1B
Binding AffinitySelective for serotonin (5-HT) and synthetic agonists (e.g., CP-94,253)
Second MessengerCouples to Gαi/o proteins, inhibiting adenylyl cyclase and suppressing cAMP

Production Methods and Recombinant Proteins

Recombinant Htr1b is synthesized in various hosts, with purification and functional validation performed via SDS-PAGE, Western blotting, and ligand-binding assays.

Recombinant Production Parameters:

Host SystemPurityTagsApplicationsSource
E. coli≥85% (SDS-PAGE)His, GSTStructural studies, ligand-screening
Mammalian cells≥85% (SDS-PAGE)Fc, SUMOFunctional assays, cell signaling
Wheat germ/insect cells≥85% (SDS-PAGE)Avi, FlagReceptor-ligand interaction studies

Functional Validation:

  • Ligand Binding: Binds serotonin with high affinity (~nM range) and agonists like CP-94,253 .

  • cAMP Inhibition: Suppresses forskolin-induced cAMP production in transfected cells (e.g., HEK293) .

Research Applications

Recombinant Htr1b is utilized in pharmacological and neurobiological studies to elucidate receptor mechanisms and therapeutic targets.

Key Applications:

ApplicationMethodologyOutcomeSource
Structural AnalysisX-ray crystallography (e.g., methiothepin binding)Reveals inverse agonist binding mode
Motor Function StudiesBehavioral assays in Htr1b-KO miceLinks receptor loss to age-related motor decline
Antidepressant ScreeningcAMP inhibition assaysIdentifies selective 5-HT1B agonists

Pharmacological Profile

Recombinant Htr1b serves as a model for testing small-molecule interactions, particularly in migraine and psychiatric disorders.

Selective Ligands:

Ligand TypeExamplesActionSelectivitySource
AgonistsCP-94,253, BRL-15572Activate receptor, inhibit cAMP5-HT1B > 5-HT1D
AntagonistsMethiothepin, SB-224289Block serotonin bindingBroad 5-HT1B/1D inhibition

A. Motor and Cognitive Roles

  • Htr1b knockout mice exhibit accelerated aging, including early motor decline and reduced longevity .

  • Presynaptic Autoreceptors: Htr1b modulates serotonin release in the striatum and cerebellum, influencing locomotion and neurotransmitter regulation .

B. Therapeutic Insights

  • Migraine Treatment: 5-HT1B agonists (e.g., frovatriptan) target Htr1b to induce vasoconstriction .

  • Anxiety and Depression: Viral overexpression of Htr1b in the caudal dorsal raphe nucleus reduces stress-induced anxiety in rats .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
Htr1b; 5ht1b; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEEQGIQCAPPPPAASQTGVPLTNLSHNCSADGYIYQDSIALPWKVLLVALLALITLATT LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF WLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKRTPKRAAIMIVLVWVFSISISLPP FFWRQAKAEEEMLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP NKTGKRLTRAQLITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKL MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI NPIIYTMSNEDFKQAFHKLIRFKCAG
Uniprot No.

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). It also acts as a receptor for various alkaloids and psychoactive substances. Ligand binding induces a conformational change that triggers signaling via guanine nucleotide-binding proteins (G proteins), thereby modulating the activity of downstream effectors, such as adenylate cyclase. Signaling inhibits adenylate cyclase activity. Arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. It regulates the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, influencing neural activity, nociceptive processing, pain perception, mood, and behavior. Additionally, it plays a role in vasoconstriction of cerebral arteries.
Gene References Into Functions
  1. In line with previous studies involving optogenetic inhibition of vHPC-mPFC projections, activating prefrontal 5-HT1B receptors suppressed theta-frequency mPFC activity (4-12 Hz) and reduced avoidance of anxiogenic regions in the elevated plus maze PMID: 27974203
  2. Mice lacking 5-HT1B autoreceptors exhibited the expected increases in extracellular serotonin levels in the ventral hippocampus following administration of a selective serotonin reuptake inhibitor. PMID: 27353308
  3. 5-HT1B receptor-dependent cellular Src-related kinase-Nox1-pathways contribute to vascular remodeling in pulmonary arterial hypertension. PMID: 28473438
  4. 5-HT1B Knockout and pharmacologic 5-HT1B antagonism both attenuated locomotor hyperactivity in dopamine transporter Knockout mice. PMID: 25514162
  5. 5-HT1BR was validated as a target for miRNA-96. Transfection of precursor miRNA-96 into hPASMCs reduced 5-HT1BR expression and inhibited serotonin-induced proliferation in pulmonary hypertension development. PMID: 25871906
  6. The data from this study showed that while adolescent expression of 5-HT1BRs influences aggressive behavior, a distinct set of 5-HT1B receptors modulates impulsive behavior during adulthood. PMID: 25892302
  7. 5-HT(1B)R stimulation increased glutamatergic neurotransmission in the hippocampus in p11KO mice, but not in WT mice. Hippocampal p11 determines the directionality of 5-HT(1B)R action on emotional memory processing PMID: 23032875
  8. Selective inhibition of 5-HT2A by sarpogrelate stimulated angiogenesis, restoring ischemic limb blood perfusion in a severe diabetic mouse model through stimulation of the eNOS/Akt pathway via the endothelial 5-HT1B receptor. PMID: 22172591
  9. Data indicate that most p11 expressing cells in cerebral cortex, hippocampus, cerebellum, & caudate-putamen express HTR1B or co-express HTR1B/HTR4, suggesting a crucial role for p11 in modulating actions of serotonin via these receptor subtypes. PMID: 21300076
  10. In the developing barrel field of neonatal mice, 5-HT1B receptors mediate an activity-dependent regulation of the thalamocortical EPSC that could favor the propagation of high-frequency thalamocortical activity PMID: 11826118
  11. 5-Hydroxytryptamine(1B/1D) receptors inhibit capsaicin-induced c-fos immunoreactivity within mouse trigeminal nucleus caudalis. PMID: 12110114
  12. Endogenous activation of 5-HT1B presynaptic receptors modulates circadian behavior by attenuating photic input to the suprachiasmatic nucleus PMID: 12375619
  13. The influence of the pre- and postweaning maternal environment on the offspring's phenotype was examined in 5-HT1A and 5-HT1B receptor knockout mice (KO1A and KO1B, respectively. PMID: 12555283
  14. Serotonin 1B receptor gene deletion selectively enhances learning performance when the cognitive requirement of the task is elevated. PMID: 12565126
  15. 5-HT(1B) receptors appear to play a significant role in impulsivity and a minor role in prefrontal cortex-dependent learning and memory, as demonstrated by the results obtained in serial reversal learning and extinction PMID: 12742250
  16. Delay-dependent working memory is impaired in young-adult and aged 5-HT1B knockout mice PMID: 14557613
  17. These studies revealed a beneficial effect of the mutation on the acquisition of a spatial reference memory task, but a detrimental effect on a working memory task for long delays. PMID: 14657258
  18. Presynaptic serotonergic modulation of the retinogeniculate synapse occurred primarily through 5-HT1B receptors, resulting in inhibition of synaptic release and relief of synaptic depression. PMID: 15574745
  19. PrPC is a modulator of 5-HT receptor coupling to G-proteins and contributes to the homeostasis of serotonergic neurons PMID: 15590675
  20. Results from this study indicate that the dynamic modulation of 5-HT1B receptor function by p11 may be involved in molecular adaptations occurring in neuronal networks that are dysfunctional in depression-like states PMID: 16400147
  21. Knockout mice exhibit changes in the increase in cortical serotonin outflow caused by systemic injection of paroxetine compared with normal mice. PMID: 16433012
  22. Role of 5-HT1B receptors in photic entrainment PMID: 16461982
  23. Lack of serotonin1B receptor expression leads to age-related motor dysfunction, early onset of brain molecular aging, and reduced longevity. PMID: 17420766
  24. Early-weaned mice were more aggressive after food restriction stress than normally weaned mice and had lower 5HT1B expression. PMID: 18022705
  25. These results suggest that 5-HT(1B) receptors in the mPFC may serve to selectively disinhibit aggressive behavior in mice with a history of alcohol self-administration. PMID: 18305458
  26. Increases in D2 binding sites, presumably involving GABAergic projection neurons, were measured in the nucleus accumbens, olfactory tubercle, and ventral tegmental area of the 5-HT1B KO. PMID: 18406571
  27. This provides a neurochemical basis for the behavioral sensitization. PMID: 18516987
  28. These results demonstrate that prenatal 5-HT excess affects, via the overactivation of 5-HT(2A)-R, the expression of 5-HT(1B)-R in phrenic motor neurons and the organization of their premotor network. PMID: 18783379

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in striatum and Purkinje cells.

Q&A

What is the 5-hydroxytryptamine receptor 1B (Htr1b) and what are its main functions?

The mouse 5-hydroxytryptamine receptor 1B (Htr1b) is an inhibitory G protein-coupled receptor (GPCR) belonging to the Class A (Rhodopsin) family of aminergic receptors . It primarily functions as:

  • A presynaptic autoreceptor on serotonergic neurons that regulates serotonin (5-HT) release through negative feedback mechanisms

  • A presynaptic heteroreceptor on non-serotonergic neurons that modulates the release of other neurotransmitters

  • A key mediator in various physiological and behavioral processes including mood regulation, anxiety, depression, and cognitive functions

The receptor plays a critical role in the negative feedback control of serotonergic transmission and has been implicated in various psychiatric disorders. Research has demonstrated that blocking 5-HT1B autoreceptors may have therapeutic potential for treating anxiety and depression .

How is Htr1b distributed in the mouse brain?

The distribution of Htr1b in the mouse brain shows an interesting dissociation between receptor protein localization and mRNA expression:

Htr1b Protein Distribution:

  • Abundant in basal ganglia structures, particularly the globus pallidus and substantia nigra

  • Present in the dorsal subiculum of the hippocampal formation

  • Found in the amygdala

  • Concentrated in terminal fields of serotonergic projections

Htr1b mRNA Distribution:

  • Dense expression in the subthalamic nucleus of the basal ganglia

  • Concentrated in the pyramidal cell layer of the CA1 area of the hippocampus

  • Notably absent in the globus pallidus, substantia nigra, and dorsal subiculum

This differential distribution pattern indicates that the receptor is synthesized in cell bodies (where mRNA is detected) but transported to and expressed in terminal regions (where protein is detected), consistent with its predominant role as a presynaptic receptor.

What experimental models are available for studying Htr1b function?

Researchers employ several complementary approaches to study Htr1b function:

Genetic Models:

  • Conventional knockout models with global Htr1b deletion

  • Conditional knockout models with cell-type specific deletion

  • Selective autoreceptor ablation models that specifically target the 5-HT1B receptors on serotonergic neurons

  • CRISPR-Cas9 gene-edited mice with specific point mutations or polymorphisms

Pharmacological Models:

  • Administration of selective Htr1b agonists (e.g., CP93129, CP94253)

  • Studies with selective antagonists (e.g., NAS-181) that show effects on cognitive function

  • Combined approaches with serotonin reuptake inhibitors to study autoreceptor function

Behavioral Paradigms for Phenotypic Assessment:

  • Open field test for anxiety-like behavior evaluation

  • Forced swim and sucrose preference tests for depression-like behavior assessment

  • Water maze and contextual fear conditioning for cognitive evaluation

  • Various impulsivity and aggression paradigms

What are the functional consequences of Htr1b manipulation in mouse models?

Manipulation of Htr1b expression and activity in mice produces several notable behavioral and neurochemical effects:

Knockout Models Show:

  • Decreased anxiety-like behavior in open field tests

  • Antidepressant-like effects in the forced swim test

  • Enhanced preference in the sucrose preference test (reduced anhedonia)

  • Enhanced spatial performance in water maze tasks in some studies

  • Increased extracellular serotonin levels in the ventral hippocampus following SSRI administration

Antagonist Administration Produces:

  • Facilitation of certain aspects of cognitive function

  • Enhanced cholinergic transmission, suggesting receptor interaction with the cholinergic system

  • Effects that generally parallel genetic deletion models

Agonist Studies Demonstrate:

  • Opposing effects to antagonists in cognitive tasks

  • Potential acute anxiolytic effects through specific neural circuit activation

  • Alterations in impulsivity and decision-making processes

How does Htr1b interact with other neurotransmitter systems?

The 5-HT1B receptor engages in significant cross-talk with multiple neurotransmitter systems:

Cholinergic System:

  • Htr1b heteroreceptors on cholinergic terminals regulate acetylcholine release

  • Blockade of Htr1b can enhance cholinergic transmission, particularly in brain regions associated with cognitive function

  • This interaction appears important for learning and memory processes

Glutamatergic System:

  • Modulation of glutamate release in cortical and limbic circuits

  • Effects on excitatory/inhibitory balance in key brain regions

GABAergic System:

  • Regulation of GABA release in multiple brain regions

  • Contributions to anxiety-related neural circuits

Dopaminergic System:

  • Influences on dopamine release in reward-related areas

  • Effects on locomotor activity regulation in basal ganglia circuits

These interactions create a complex network of effects that contribute to the diverse behavioral phenotypes observed with Htr1b manipulation.

How do 5-HT1B autoreceptors and heteroreceptors differentially regulate neurotransmission?

5-HT1B receptors serve dual roles as autoreceptors and heteroreceptors, with distinct functional implications:

Autoreceptor Function:

  • Located specifically on serotonergic terminals

  • Inhibits 5-HT release through negative feedback mechanisms

  • Regulates serotonergic tone throughout the brain

  • Modulates the efficacy of serotonin reuptake inhibitors

  • Selective ablation leads to increased extracellular serotonin levels and antidepressant-like behavioral effects

Heteroreceptor Function:

  • Expressed on non-serotonergic terminals (glutamatergic, GABAergic, cholinergic)

  • Inhibits release of various neurotransmitters upon activation by serotonin

  • Creates complex circuit-level effects across brain regions

  • Contributes to cognitive effects through modulation of cholinergic transmission

The selective genetic ablation of 5-HT1B autoreceptors represents a significant methodological advance in distinguishing between these functions, allowing researchers to specifically study autoreceptor-mediated effects while leaving heteroreceptor populations intact .

What molecular mechanisms underlie Htr1b effects on anxiety and depression-like behaviors?

The 5-HT1B receptor modulates anxiety and depression-related behaviors through several molecular mechanisms:

Serotonergic Signaling:

  • Autoreceptor-mediated control of 5-HT release in key brain regions

  • Altered serotonergic tone in the ventral hippocampus and other limbic structures

  • Increased extracellular serotonin levels following selective serotonin reuptake inhibitor administration in mice lacking 5-HT1B autoreceptors

Signal Transduction Pathways:

  • Inhibition of adenylyl cyclase and subsequent cAMP production

  • Modulation of ion channels affecting neuronal excitability

  • Activation of various intracellular signaling cascades

Neural Circuit Effects:

  • Altered activity in amygdala-prefrontal cortex-hippocampal circuits

  • Modifications to anxiety and fear processing networks

  • Regulation of stress response circuitry

The evidence from genetic models provides strong support for therapeutic strategies targeting 5-HT1B receptors: "These results suggest that strategies aimed at blocking 5-HT1B autoreceptors may be useful for the treatment of anxiety and depression" .

How do genetic polymorphisms in Htr1b influence susceptibility to depression and suicidal behavior?

Genetic variation in the Htr1b gene has significant implications for depression and suicidal behavior:

Key Polymorphisms and Their Effects:

  • rs6296 (G861C) has been significantly associated with major depressive disorder (MDD) risk

  • rs6298 shows significant association with lethality of suicide attempts

  • These polymorphisms may affect receptor expression, binding properties, or signaling efficiency

Meta-Analysis Findings:

  • Carriers with rs6296 GC and GC/CC genotypes demonstrate a 1.26- and 1.22-fold increased risk of MDD, respectively

  • Carriers with rs6298 CT genotype show a 1.48-fold increased risk of suicidal behavior

Mechanistic Explanations:

  • Altered serotonergic signaling in key brain regions

  • Modified response to stressors or emotional stimuli

  • Potential interactions with environmental risk factors

These genetic associations provide valuable insights for personalized medicine approaches and highlight the importance of 5-HT1B receptor function in mood regulation and suicidal behavior.

What methodological approaches can selectively target Htr1b autoreceptors versus heteroreceptors?

Distinguishing between Htr1b autoreceptor and heteroreceptor functions requires sophisticated experimental approaches:

Genetic Approaches:

  • Conditional knockout models using cell-type specific promoters

  • Development of specialized genetic mouse models allowing selective ablation of 5-HT1B autoreceptors while preserving heteroreceptor function

  • Viral vector-mediated selective manipulation of receptor expression

Pharmacological Strategies:

  • Regional microinjection of selective ligands

  • Use of compounds with differential penetration of receptor subpopulations

  • Combined application of serotonergic and non-serotonergic system manipulations

Neurochemical Techniques:

  • In vivo microdialysis with pharmacological challenges to isolate receptor subtype effects

  • Fast-scan cyclic voltammetry for real-time 5-HT detection

  • Combined measurement of multiple neurotransmitters to assess cross-system effects

The development of models that can selectively target autoreceptors represents a significant methodological advance, overcoming the challenge that "The autoreceptor population located on the axon terminals of 5-HT neurons is a difficult population to study due to their diffuse localization throughout the brain that overlaps with 5-HT1B heteroreceptors" .

How does Htr1b modulation affect cognitive function, and what are the underlying mechanisms?

The 5-HT1B receptor plays a nuanced role in cognitive function through several mechanisms:

Behavioral Effects:

  • Antagonism of 5-HT1B receptors can facilitate aspects of cognitive function

  • Knockout models show enhanced spatial performance in some paradigms

  • Different cognitive domains (spatial learning, aversive conditioning, working memory) may be differentially affected

Neurotransmitter Interactions:

  • Enhanced cholinergic transmission appears to be a key mechanism through which 5-HT1B antagonists improve cognitive function

  • Effects on glutamatergic signaling in hippocampal and cortical circuits

  • Modulation of excitatory/inhibitory balance in cognitive networks

Regional Specificity:

  • Effects may vary across brain regions relevant to different cognitive processes

  • Hippocampal 5-HT1B receptors influence spatial learning and memory

  • Prefrontal cortical receptors affect executive functions and working memory

As noted in research findings: "the 5-HT1B antagonist NAS-181 can facilitate some aspects of cognitive function, most likely via an increase of cholinergic transmission. These results suggest that 5-HT1B receptor antagonists may have a potential in the treatment of cognitive deficits resulting from loss of cholinergic transmission" .

What are optimal expression systems for recombinant mouse Htr1b production?

Various expression systems have been developed for recombinant mouse Htr1b production, each with specific advantages:

Mammalian Cell Expression:

  • HEK293 and CHO cells provide proper post-translational modifications

  • Stable cell lines allow consistent receptor expression

  • Tetracycline-inducible systems offer controlled expression levels

  • Appropriate for functional studies requiring correct G-protein coupling

Insect Cell Expression:

  • Baculovirus-infected Sf9 or High Five cells yield higher protein amounts

  • Suitable for structural studies requiring large quantities of purified receptor

  • May require optimization of culture conditions for proper folding

Bacterial Systems:

  • E. coli-based systems for fragment expression and antibody production

  • Fusion proteins can improve solubility and expression levels

  • Limited utility for full-length functional receptor expression

Optimization Recommendations:

  • Addition of N-terminal signal sequences and C-terminal tags

  • Incorporation of thermostabilizing mutations for structural work

  • Cholesterol supplementation in membrane environments

  • Careful selection of detergents for solubilization

What are the critical validation steps for confirming functional Htr1b expression?

Validation of functional recombinant Htr1b expression requires a multi-tiered approach:

Molecular Validation:

  • PCR and sequencing to confirm correct gene insertion and sequence

  • Quantitative RT-PCR to assess mRNA expression levels

  • Western blotting for protein expression using selective antibodies

Pharmacological Validation:

  • Radioligand binding assays with selective 5-HT1B ligands

  • Competition binding studies with known agonists and antagonists

  • Functional assays measuring G-protein activation (GTPγS binding)

  • Second messenger assays (inhibition of cAMP production)

Functional Cellular Validation:

  • Calcium mobilization assays where appropriate

  • MAPK phosphorylation assessment

  • Electrophysiological recordings in cell systems

  • Receptor trafficking and internalization studies

Biological Activity Confirmation:

  • Demonstration of appropriate inhibitory effects on neurotransmitter release

  • Proper responses to known Htr1b ligands

  • Comparisons to native receptor properties in brain tissue preparations

What experimental design approaches best address the challenges of studying region-specific Htr1b function?

Studying region-specific Htr1b function presents several methodological challenges that can be addressed through careful experimental design:

Challenge: Overlapping Populations
"The autoreceptor population located on the axon terminals of 5-HT neurons is a difficult population to study due to their diffuse localization throughout the brain that overlaps with 5-HT1B heteroreceptors"

Solution Approaches:

  • Targeted viral vector delivery for region-specific manipulation

  • Dual recombinase systems (Cre/Flp) for precise cell-type targeting

  • Optogenetic stimulation of specific 5-HT projections

  • Pharmacological microinjections with careful anatomical controls

Challenge: Separating Direct vs. Indirect Effects

Solution Approaches:

  • Ex vivo slice electrophysiology with specific pathway stimulation

  • Designer receptors exclusively activated by designer drugs (DREADDs)

  • Combined in vivo imaging and behavioral testing

  • Circuit mapping with retrograde and anterograde tracers

Challenge: Network Adaptations Following Manipulations

Solution Approaches:

  • Inducible genetic systems for temporal control

  • Acute pharmacological interventions

  • Within-subject designs where possible

  • Comprehensive assessment across multiple behavioral domains

What are the most sensitive methods for measuring Htr1b-mediated changes in neurotransmitter release?

Several advanced techniques provide sensitive measurement of Htr1b-mediated changes in neurotransmitter release:

TechniqueTemporal ResolutionSpatial ResolutionKey Applications for Htr1b Research
Fast-Scan Cyclic VoltammetrySubsecond (10-100ms)~100μmReal-time detection of 5-HT release during behavior; measuring autoreceptor-mediated inhibition
Microdialysis with HPLC/MSMinutes (10-20min)~1mmMeasuring basal and stimulated extracellular 5-HT levels; increased 5-HT levels following SSRI in Htr1b knockout mice
Genetically-Encoded SensorsSubsecond (100ms)Cellular (with two-photon)Cell-type specific monitoring of 5-HT dynamics; circuit-specific effects
Synaptosome SuperfusionMinutesEx vivo preparationIsolating terminal autoreceptor vs. heteroreceptor effects
Electrophysiology with PharmacologyMillisecondSingle-cellDirect measurement of receptor-mediated changes in neural activity

Each method offers distinct advantages, and combinations of techniques can provide comprehensive understanding of Htr1b function across multiple levels of analysis.

How can contradictory findings on Htr1b function across different behavioral paradigms be resolved?

Researchers often encounter contradictory findings regarding Htr1b function across different behavioral paradigms. These apparent discrepancies can be systematically addressed:

Paradigm-Specific Effects:

  • Different behavioral tests measure distinct psychological constructs

  • "A study using 5-HT1B receptor knockout mice reported enhanced spatial performance in the water maze (WM), but no effect in a contextual fear..."

  • Task parameters (difficulty, stress level, novelty) significantly influence receptor involvement

Methodological Variations:

  • Differences between pharmacological and genetic approaches

  • Acute vs. chronic manipulations may produce opposite effects

  • Laboratory environment differences impact behavioral outcomes

  • Mouse strain background influences phenotypic expression

Brain Region and Circuit Specificity:

  • The same receptor can have opposing functions in different neural circuits

  • Region-specific manipulations produce varying behavioral profiles

  • Consideration of developmental timing and compensatory mechanisms

Reconciliation Framework:

  • Multi-level analysis from molecules to behavior

  • Systems neuroscience approaches to understand network effects

  • Recognition of biological heterogeneity and individual differences

  • Careful parameter matching and standardization across studies

What mechanisms explain the differential effects of Htr1b modulation on anxiety versus cognitive function?

The seemingly distinct effects of Htr1b modulation on anxiety versus cognitive function can be explained through several mechanisms:

Neural Circuit Separation:

  • Anxiety behaviors primarily involve amygdala, BNST, and prefrontal-limbic circuits

  • Cognitive functions depend more on hippocampal-cortical and basal forebrain-cortical circuits

  • Different 5-HT1B receptor densities and functions across these circuits

Neurotransmitter System Interactions:

  • Anxiety modulation may operate primarily through direct serotonergic effects

  • Cognitive enhancement appears to involve cholinergic system interactions

  • Different downstream effector mechanisms in emotional versus cognitive circuits

Temporal Dynamics:

  • Rapid effects on anxiety-related behaviors

  • More gradual or state-dependent effects on cognitive processes

  • Different adaptation timeframes across neural systems

Mechanistic Evidence:

  • "Mice lacking 5-HT1B autoreceptors displayed decreased anxiety-like behavior in the open field"

  • "The 5-HT1B antagonist NAS-181 can facilitate some aspects of cognitive function, most likely via an increase of cholinergic transmission"

These different mechanisms provide a framework for understanding how the same receptor can have distinct effects across behavioral domains.

What are the most promising future directions for Htr1b research?

The study of the mouse 5-hydroxytryptamine receptor 1B (Htr1b) continues to evolve with several promising research directions:

Therapeutic Applications:

  • Development of selective 5-HT1B autoreceptor antagonists for anxiety and depression

  • Targeting receptor polymorphisms for personalized medicine approaches

  • Exploration of cognitive enhancement potential through cholinergic mechanisms

Methodological Advances:

  • Further refinement of cell-type and circuit-specific genetic tools

  • Development of more selective pharmacological compounds

  • Application of emerging technologies like genetically-encoded sensors

  • Integration of multi-modal assessment approaches

Mechanistic Investigations:

  • Deeper understanding of the molecular mechanisms distinguishing autoreceptor and heteroreceptor functions

  • Clarification of the role of specific genetic polymorphisms in disease susceptibility

  • Exploration of receptor interactions with multiple neurotransmitter systems

The evidence that "strategies aimed at blocking 5-HT1B autoreceptors may be useful for the treatment of anxiety and depression" and that "5-HT1B receptor antagonists may have a potential in the treatment of cognitive deficits" highlights the translational potential of this research area.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.