Recombinant Mouse 5-hydroxytryptamine receptor 3A (Htr3a)

Shipped with Ice Packs
In Stock

Description

Expression Systems

  • E. coli: Most common host for cost-effective production, yielding >90% purity via Ni-NTA affinity chromatography .

  • HEK293F cells: Alternative for post-translational modifications, though less frequently used for mouse Htr3a .

Purification Protocol

  1. Solubilization: Membranes treated with C12E9 detergent .

  2. Affinity Chromatography: His tag-based purification .

  3. Size-Exclusion Chromatography (SEC): Confirms pentameric assembly (observed for human homologs) .

ParameterSpecification
Purity≥90% (SDS-PAGE)
Storage-80°C in Tris/PBS buffer with 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Functional Studies

  • Electrophysiology: Measures ion flux (Na+/K+/Ca²⁺) in response to serotonin .

  • Structural Biology: Negative-stain EM reveals pentameric architecture homologous to human 5-HT3A .

Disease Models

  • Neurodevelopmental Disorders: Htr3a-knockout mice exhibit reduced anxiety and altered cortical dendritic complexity .

  • Gastrointestinal Dysfunction: Role in serotonin-evoked visceral pain pathways .

Species-Specific Variants

SpeciesTM DomainsAA LengthIon ConductanceKey Reference
Mouse (Htr3a)44870.4–0.8 pS
Human (HTR3A)447816 pS (with HTR3B)
Rat (Htr3a)4483Similar to mouse

Functional homopentamers in mice show lower conductance than human heteromers (e.g., HTR3A/HTR3B) .

Quality Control

  • SDS-PAGE: Single band at ~55 kDa confirms homogeneity .

  • Activity Assays: Ligand-binding affinity (Kd = 2–10 nM for serotonin) validated via radiolabeled [³H]-GR65630 .

Limitations and Alternatives

  • Low Conductance: Mouse Htr3a homomers exhibit weaker currents than heteromeric human receptors, limiting electrophysiological resolution .

  • Alternatives: Co-expression with Htr3b enhances functionality but complicates purification .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage state, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please specify your desired tag type if you have one, and we will prioritize its development during the production process.
Synonyms
Htr3a; 5ht3; Htr3; 5-hydroxytryptamine receptor 3A; 5-HT3-A; 5-HT3A; 5-hydroxytryptamine receptor 3; 5-HT-3; 5-HT3R; Serotonin receptor 3A; Serotonin-gated ion channel receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-487
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
SRRRATQEDTTQPALLRLSDHLLANYKKGVRPVRDWRKPTTVSIDVIMYAILNVDEKNQV LTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYV HHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINITLWRSPEEVRSD KSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYVIIRRRPLFYAVSLLLPSIFLMVV DIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLPATIGTPLIGVYFVVCMALLVISL AETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCLGEQPMAHRPPATFQANKTDDCSG SDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREASLAVRGLLQELSSIRHFLEKRDE MREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSIWHYS
Uniprot No.

Target Background

Function
This receptor represents one of several types of receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone acting as a neurotransmitter, hormone, and mitogen. This receptor is a ligand-gated ion channel, and its activation leads to rapid, depolarizing responses in neurons. It exhibits cation specificity but is relatively nonselective in terms of ion channel permeability.
Gene References Into Functions
  1. A triad of residues aligning with Thr-152, Glu-209, and Lys-211 in Htr3, appear to be involved in side-chain interactions near binding sites in Htr3a (subunit alpha) and muscle-type Chrna1. Evidence suggests that mutating the Htr3a triad to resemble that of Chrna1 enhances the binding affinity of nicotine to Htr3a. (Htr3 = 5-hydroxytryptamine/serotonin receptor; Chrna1 = cholinergic receptor nicotinic alpha polypeptide 1) PMID: 29298898
  2. Findings indicate that 5-HT3AR is expressed in GABAergic interneurons containing somatostatin or calretinin, with the strongest expression observed in the olfactory bulb, cerebral cortex, hippocampus, and amygdala. The pons, medulla, and spinal cord exhibit partial 5-HT3AR expression. Minimal expression of 5-HT3AR is seen in the thalamus, hypothalamus, and midbrain, while the cerebellum shows no expression. PMID: 28276429
  3. Knockdown of serotonin receptors 5-HTR3 and 5-HTR4 in neonatal cardiomyocytes resulted in a significant increase in cell damage in response to hypoxia and alterations in heart beating. PMID: 27874067
  4. Analysis of the structure of the full-length 5-HT3AR channel in the apo-state was determined through single-particle cryo-electron microscopy. PMID: 29410406
  5. Communication between taste cells and 5-HT3A-expressing afferent nerve fibers is involved in the transmission of sour taste information. PMID: 28316078
  6. Characterization of the recently available murine 5-HT3 receptor was achieved by identifying sites of strong interaction with specific functional groups at both the orthogonal (serotonin) site and a proposed allosteric binding site located at the interface between the transmembrane region and the extracellular domain. PMID: 27816008
  7. It is concluded that cholera toxin inhibits colonic migrating motor complexes through the release of mucosal 5-HT, which subsequently activates an inhibitory pathway involving 5-HT3 receptors. PMID: 26990461
  8. This study suggests that epithelial 5-HT3 receptor may function as a mediator of gut microbiota-driven changes in intestinal secretion. PMID: 28408644
  9. Deletion of the 5HT3A receptor in neuroblasts impaired migration speed and directionality, and eliminated calcium spikes. PMID: 28472655
  10. The antidepressant bupropion is identified as a negative allosteric modulator of serotonin type 3A receptors. Results demonstrate allosteric blockade of the 5-HT3AR by bupropion. PMID: 27671323
  11. Studies with 16 arylguanidines found their functional activity spanning a wide range, from superagonist to full agonist, partial agonist, and antagonist at 5-HT3 receptors. Findings confirm the utility of phenylguanidine as a versatile scaffold in the design of 5-HT3 ligands with adjustable agonist or antagonist activity. PMID: 27533595
  12. 5-HT3A-ICD is not only essential but also sufficient for interaction with RIC-3. PMID: 27045630
  13. This study demonstrated that the 5-HT3 receptor is the crucial target of 5-HT action in exercise-induced hippocampal neurogenesis and antidepressant effects, but not in learning enhancement. PMID: 25403840
  14. Deletion of the Htr3a gene was associated with fatal arrhythmias and sudden cardiac death during pregnancy, and its activation reversed QT prolongation. PMID: 25986676
  15. This study suggests that 5-HT released from type III cells activates gustatory nerve fibers via 5-HT3 receptors, contributing significantly to the neural taste response. PMID: 26631478
  16. Htr3a is required for regulating the migration and laminar positioning of reelin-expressing interneurons in the neocortex. PMID: 25409778
  17. Deletion of the 5-HT3AR gene in transgenic mice abolished N-methyl-d-aspartate (NMDA) receptor (NMDAR)-dependent long-term depression (LTD) induced by low-frequency stimulation (LFS) in hippocampal CA1 synapses in slices. PMID: 25130560
  18. 5HT2AR and 5HT3AR were detected using RT-PCR techniques. PMID: 24969868
  19. Results indicate that vestibular ganglion cells express functional 5-HT3 receptor channels (with 5-HT3a and 5-HT3b subunits) and may play a modulatory role in the peripheral vestibular nervous system. PMID: 24530269
  20. The 5-HT system in the small intestine may play a crucial role in regulating circadian rhythms through the activation of 5-HT3/5-HT4-receptors. PMID: 24492464
  21. The X-ray structure of a mammalian Cys-loop receptor, the mouse serotonin 5-HT3 receptor, was determined at 3.5 A resolution. PMID: 25119048
  22. This study suggests that the 5-HT3A receptor could be a key molecule regulating fear memory processes and a potential therapeutic target for fear disorders. PMID: 24344177
  23. Serotonin, acting in a paracrine/autocrine manner through Htr3, lowers the beta cell threshold for glucose and plays an essential role in the increased glucose-stimulated insulin secretion of pregnancy. PMID: 24218571
  24. 5-HT3 and NK1 immunopositive macrophages and mucosal mast cells release 5-HT and substance P, which in turn activate their corresponding receptors on mucosal cells through autocrine and paracrine mechanisms. PMID: 23695873
  25. Alcohol consumption induces changes in Htr3a promoter DNA methylation in both blood and brain. PMID: 22834954
  26. Serotonin 5-HT3 receptors control the morphological maturation of Purkinje cells through reelin. PMID: 23318873
  27. In a mutant cycle analysis, residue Asp124 of loop A in the 5-HT3A receptor forms two functionally significant hydrogen bonds to the backbone of loop B, an interaction crucial for receptor function. PMID: 23077719
  28. This study demonstrated the presence of 5-hydroxytryptamine 3A receptor-expressing cells within the adult SVZ-RMS-OB system. PMID: 23041763
  29. This study showed that knockout mice lacking the 5-HT(3A) receptor exhibited exuberant apical dendrites of cortical pyramidal neurons. PMID: 22696545
  30. Activation of central 5-HT(3) receptors is more effective in inducing hypothermia due to a significant decrease in thermogenesis and an increase in heat loss. It shifts metabolism to primarily utilize lipids as the main energy source. PMID: 21964386
  31. Stimulation of the 5-HT3 serotonin receptor exacerbates extrapyramidal motor symptoms, while antagonism of this receptor alleviates extrapyramidal motor disorder symptoms. PMID: 20813116
  32. BDNF facilitates gamma oscillations in the hippocampus by attenuating signaling through the 5-HT3 receptor. PMID: 21298058
  33. Studies have concluded that 5-HT3 receptor antagonists can reduce various opioid maladaptations. PMID: 21368652
  34. The relative positions of various residues in the ligand-binding site were identified. PMID: 20441748
  35. Both serotonin and granisetron bind to an AA binding site in the heteromeric 5-HT3AB receptor. PMID: 20409468
  36. A cation-pi interaction between serotonin and Trp-183 of the serotonin channel 5-HT3AR has been identified, precisely locating the ligand-binding site of this receptor. PMID: 12162741
  37. Adaptive changes occur in the subunit composition of enteric 5-HT(3) receptors of 5-HT transporter -/- mice, reflected in 5-HT(3) receptor affinity and desensitization. PMID: 12388212
  38. Species-dependent gating mechanism of 5-HT(3) receptors were explored. PMID: 12457738
  39. A serotonin transporter gene promoter variant was found in panic disorder. PMID: 12607224
  40. 5HT3A receptor function and trafficking is regulated by protein kinase c through an F-actin-dependent mechanism. PMID: 12791692
  41. This study describes homology modeling of the N-terminal extracellular regions of human, mouse, and guinea pig 5-hydroxytryptamine type 3A receptors. PMID: 14626451
  42. The homopentameric 5-HT3A receptor is localized both to the plasma membrane and within intracellular compartments of living cells. PMID: 15009132
  43. hRIC-3 can act as a specific regulator of alpha7 and 5-HT3 expression at different levels by increasing the number of mature receptors and facilitating their transport to the membrane. PMID: 15927954
  44. Residues F226 and Y234 of the 5-hydroxytryptamine (serotonin) receptor are important for both 5-HT and mCPBG interactions. PMID: 15966738
  45. These results confirm the structure of the M2-M3 loop and the crucial role of Pro 8* in the 5-HT3 receptor. Additionally, they suggest that a molecular rearrangement at Pro 8* is the structural mechanism that opens the receptor pore. PMID: 16281040
  46. The arginine 427 residue in the large cytoplasmic domain contributes to 5-HT3A receptor desensitization, possibly through forming an electrostatic interaction with its neighboring residues. PMID: 16754678
  47. This study tested the hypothesis that loop F plays a significant role in conferring interspecies curare potency differences. Two loop F residues were found to make a significant contribution in determining curare potency at the 5-HT3A receptor. PMID: 17260949
  48. These data demonstrate a role for the 5-HT(3A)-receptor subunit in the induction of behavioral sensitization to cocaine. This suggests that the 5-HT(3A) molecular subunit modulates neurobehavioral adaptations to cocaine, potentially underlying aspects of addiction. PMID: 17559417
  49. 5-HT mediates enhanced neurogenic contractions of the mouse bladder muscle through an action at 5-HT(3) receptors. The presence of the 5-HT(3) receptor was confirmed by the expression of both 5-HT(3A) and 5-HT(3B) receptor subunits. PMID: 17607564
  50. Results imply that the M3M4 loop is not essential for 5-HT3A receptor assembly and function. This suggests that the cytoplasmic domain may fold as an independent module from the transmembrane and extracellular domains. PMID: 18227272

Show More

Hide All

Database Links

KEGG: mmu:15561

STRING: 10090.ENSMUSP00000003826

UniGene: Mm.4831

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily, HTR3A sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain, spinal cord, and heart.

Q&A

What is the basic structural composition of mouse 5-HT3A receptors?

Mouse 5-HT3A receptors are cation-selective members of the Cys loop receptor family. They form pentameric structures in the cell membrane with an extracellular N-terminal domain containing the ligand-binding site, four transmembrane domains, and a large intracellular loop between M3 and M4. The 5-HT3A subunit is capable of forming functional homomeric receptors, unlike other subunits (B-E) that require co-assembly with at least one 5-HT3A subunit to form functional heteromeric receptors .

How does the agonist-binding site of mouse 5-HT3A receptors function?

The agonist-binding site of mouse 5-HT3A receptors is located at the interface between two adjacent subunits in the extracellular domain. It is formed by three loops (A-C) from one subunit (principal) and three β-strands (loops D-F) from the adjacent subunit (complementary). Key residues include Glu-129 in loop A, which forms a hydrogen bond with the hydroxyl group of 5-HT, and Trp-183 in loop B, which forms a critical cation-π interaction with the primary amine of 5-HT . The binding pocket contracts around agonists, which may initiate the conformational change leading to channel opening .

What are the electrophysiological characteristics of mouse 5-HT3A receptors?

Mouse 5-HT3A homomeric receptors exhibit distinctive electrophysiological properties:

  • Slow activation time course with a 10-90% rise time of 12.5 ± 1.6 ms for 100 μM serotonin application

  • EC50 value of approximately 2 μM for peak serotonin response with a Hill slope of 3.0, suggesting at least three agonist molecules must bind to open the channel

  • Peak open probability greater than 0.8 under optimal conditions

  • Variable open probability that changes with the number of serotonin molecules bound, showing a reduced open probability for fully liganded receptors

What expression systems are most efficient for producing recombinant mouse 5-HT3A receptors?

While the search results focus primarily on human 5-HT3A receptors, the methodologies are applicable to mouse receptors with appropriate modifications. The BacMam expression system has proven highly efficient for 5-HT3A receptor production:

  • BacMam system using HEK293F cells: This system yields approximately 0.5 mg of purified receptor per liter of cell culture, producing pentameric receptors with good homogeneity and monodispersity .

  • Alternative systems include stable HEK293 cell lines transiently transfected with appropriate vectors. For co-expression studies, reporter genes like green fluorescent protein (GFP) can be used to identify successfully transfected cells .

The choice of expression system should be guided by the specific research application, with mammalian cell systems generally preferred for functional studies that require proper post-translational modifications.

What purification strategies yield the highest quality mouse 5-HT3A receptors for structural studies?

For high-quality purification suitable for structural studies, a multi-step approach is recommended:

  • Membrane solubilization using detergents such as C12E9, which effectively extracts the receptor while maintaining its native conformation .

  • Affinity chromatography using tags such as MBP (Maltose Binding Protein), which provides good yields with high purity and homogeneity .

  • Size-exclusion chromatography (SEC) as a final purification step to ensure homogeneity and confirm the pentameric assembly of the receptors .

  • Quality assessment using Western blot, SDS-PAGE, and negative stain electron microscopy to verify purity, homogeneity, and proper assembly .

This approach has successfully generated samples suitable for structural analysis, including 3D reconstruction from electron microscopy data .

How does the pharmacology of mouse 5-HT3A receptors differ from human 5-HT3A receptors?

The pharmacological properties of mouse and human 5-HT3A receptors show important species-specific differences:

  • Loop C in the binding domain shows the largest species variability and is crucial in determining species-specific drug responses .

  • While both mouse and human 5-HT3A receptors respond to serotonin, differences in EC50 values and efficacy can occur.

  • Heteromeric assemblies with other subunits may show different pharmacological profiles between species. For example, the human 5-HT3A subunit corresponds to the 5-HT3A(b) isoform, which exhibits different pharmacological properties than other variants .

These species differences are critical considerations when extrapolating experimental findings from mouse to human applications, particularly in drug development research.

What methodological approaches are recommended for accurate pharmacological characterization of recombinant mouse 5-HT3A receptors?

For accurate pharmacological characterization:

  • Whole-cell patch clamp electrophysiology using rapid agonist application systems capable of submillisecond solution exchange provides detailed kinetic information about receptor activation, deactivation, and desensitization .

  • Excised membrane patches offer higher temporal resolution for studying channel kinetics compared to whole-cell recordings .

  • Concentration-response curves should be generated using a range of agonist concentrations to determine EC50 values and Hill coefficients .

  • Kinetic modeling approaches can provide insights into receptor state transitions and estimate parameters such as binding affinities and gating constants .

  • For antagonist studies, pre-application of the test compound before agonist application is recommended to allow equilibration with the receptor.

What phenotypic changes are observed in Htr3a knockout mice, and what do they reveal about receptor function?

Htr3a knockout mice display several distinctive phenotypic changes:

  • Anxiolytic-like behaviors in the elevated plus maze and social interaction tests, suggesting a role for 5-HT3A receptors in anxiety regulation .

  • Antidepressant-like behaviors in the forced swim test (FST), indicating involvement in mood regulation .

  • Altered response to antidepressants: While these mice respond normally to acute citalopram in the FST, the effects of fluoxetine are blunted, suggesting differential interactions with serotonergic pathways .

  • Protection against chronic social defeat stress (CSDS), with knockout mice showing blocked CSDS-induced modifications in cortical expression of genes involved in oxidative stress, including CaMKIIa and SOD1 .

These findings suggest that 5-HT3A receptors play important roles in anxiety, depression, stress responses, and mediation of antidepressant efficacy.

How can site-directed mutagenesis of mouse 5-HT3A receptors help elucidate structure-function relationships?

Site-directed mutagenesis is a powerful approach for structure-function studies:

  • Binding site investigations: Mutations in key residues like Glu-129 in loop A and Trp-183 in loop B have revealed their critical roles in agonist binding and receptor activation .

  • Channel gating mechanisms: Mutations in the transmembrane domains and linking regions help identify residues involved in conformational changes that couple binding to channel opening.

  • Desensitization studies: Targeted mutations in the intracellular domain can alter desensitization kinetics, revealing regulatory regions.

  • Phosphorylation site analysis: Mutations at kinase consensus sites in the large cytoplasmic M3-M4 loop can help determine the functional significance of post-translational modifications .

When designing mutagenesis experiments, consideration should be given to both conservation of residues across species and receptor subtypes, as well as the specific hypothesis being tested.

How can kinetic modeling be applied to analyze mouse 5-HT3A receptor function?

Kinetic modeling provides valuable insights into the complex behavior of 5-HT3A receptors:

  • State models incorporating multiple closed, open, and desensitized states can be developed based on electrophysiological recordings.

  • Analysis of responses to both submaximal (2 μM) and maximal (100 μM) concentrations of serotonin suggests that:

    • Homomeric mouse 5-HT3A receptors require binding of three agonist molecules to open

    • Peak open probability exceeds 0.8 under optimal conditions

    • Open probability varies with the number of bound serotonin molecules

    • Fully liganded receptors may show reduced open probability

  • Modeling also suggests that desensitization can, in some circumstances, occur more rapidly than deactivation .

This approach enables quantitative predictions about receptor behavior under various conditions and can guide experimental design for further investigations.

What methodologies are recommended for studying interactions between mouse 5-HT3A receptors and intracellular signaling pathways?

To investigate receptor-signaling pathway interactions:

  • Phosphorylation studies: The function of 5-HT3 receptors can be modulated by kinases such as PKA, PKC, and casein kinase II . Methods to study these interactions include:

    • Site-directed mutagenesis of phosphorylation consensus sequences

    • In vitro phosphorylation assays with purified kinases

    • Use of kinase activators and inhibitors in functional assays

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interacting proteins

    • FRET/BRET approaches to study dynamic interactions in living cells

    • Yeast two-hybrid screening to identify novel interaction partners

  • Cell signaling pathway analysis:

    • Calcium imaging to monitor intracellular calcium changes

    • Measurement of second messenger levels (cAMP, IP3)

    • Analysis of downstream effector activation using phospho-specific antibodies

These methods can help elucidate how 5-HT3A receptors integrate with broader cellular signaling networks.

What are the critical factors to consider when designing experiments with recombinant mouse 5-HT3A receptors?

Several factors are crucial for robust experimental design:

How should researchers address potential discrepancies between in vitro recombinant receptor data and native 5-HT3A receptor function?

To reconcile potential discrepancies:

  • Expression context effects:

    • Compare recombinant receptors in expression systems with native receptors in neuronal preparations

    • Consider the influence of membrane composition on receptor function

    • Evaluate the role of neuronal-specific regulatory proteins

  • Subunit composition variations:

    • Native 5-HT3 receptors may exist as heteromers with other subunits (B-E)

    • Systematically study how different subunit combinations affect receptor properties

    • Use subunit-specific antibodies or genetic approaches to determine native composition

  • Post-translational modifications:

    • Investigate phosphorylation states between recombinant and native systems

    • Consider glycosylation differences that may affect trafficking or function

    • Evaluate other modifications like palmitoylation or ubiquitination

  • Validation strategies:

    • Corroborate findings across multiple experimental approaches

    • Use genetic models (e.g., Htr3a knockout mice) for validation studies

    • Consider species differences when extrapolating between mouse and human systems

Understanding these factors helps bridge the gap between recombinant systems and physiological contexts, enhancing the translational relevance of findings.

What emerging technologies show promise for advancing mouse 5-HT3A receptor research?

Several cutting-edge approaches are poised to advance the field:

  • Cryo-electron microscopy for high-resolution structural studies:

    • Capable of resolving conformational states during activation and desensitization

    • Can visualize ligand binding without crystallization constraints

    • Enables structural analysis in more native-like environments

  • CRISPR-Cas9 genome editing:

    • Creation of precise receptor mutations in cell lines and animal models

    • Generation of fluorescently tagged receptors at endogenous loci

    • Development of conditional knockout models for tissue-specific studies

  • Optogenetic and chemogenetic approaches:

    • Light-activated 5-HT3A receptor variants for precise temporal control

    • Designer receptors exclusively activated by designer drugs (DREADDs) based on 5-HT3A

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize receptor clustering and trafficking

    • Single-molecule tracking to monitor receptor dynamics in real-time

    • Correlative light and electron microscopy for contextual localization studies

These technologies will provide unprecedented insights into 5-HT3A receptor biology and function.

How can computational approaches enhance our understanding of mouse 5-HT3A receptor pharmacology and function?

Computational methods offer powerful complementary approaches:

  • Molecular dynamics simulations:

    • Model conformational changes during receptor activation and desensitization

    • Predict ligand binding modes and affinities

    • Investigate water and ion movements through the channel pore

  • Machine learning approaches:

    • Predict novel ligands with desired pharmacological profiles

    • Identify patterns in receptor responses across experimental conditions

    • Classify receptor subtypes based on functional fingerprints

  • Systems biology modeling:

    • Integrate receptor function into broader neuronal network models

    • Predict consequences of receptor modulation on circuit activity

    • Model interactions between 5-HT3A receptors and other serotonergic components

  • Quantum mechanical calculations:

    • Provide detailed insights into cation-π interactions in the binding site

    • Model electronic distributions during ligand-receptor interactions

    • Calculate energetics of conformational changes during gating

These computational approaches, when integrated with experimental data, create a more comprehensive understanding of 5-HT3A receptor biology.

How do findings from mouse 5-HT3A receptor studies translate to human applications in neuropsychiatric disorders?

Translational considerations include:

  • Evidence from Htr3a knockout studies:

    • Anxiolytic- and antidepressant-like behaviors in knockout mice suggest therapeutic potential for 5-HT3 antagonists in anxiety and depression

    • Protection against stress-induced gene expression changes implies relevance for stress-related disorders

    • Modified response to antidepressants in knockout mice suggests 5-HT3 receptor blockade may enhance SSRI efficacy

  • Species differences to consider:

    • Pharmacological differences between mouse and human 5-HT3A receptors due to sequence variations, particularly in loop C

    • Different expression patterns and subunit combinations between species

    • Potential differences in receptor regulation and signaling pathways

  • Clinical correlations:

    • 5-HT3 receptor antagonists (setrons) are currently used for chemotherapy-induced and postoperative nausea and vomiting

    • Emerging evidence suggests potential applications in irritable bowel syndrome, anxiety disorders, and as adjuncts to antidepressant therapy

Understanding these translational aspects helps bridge preclinical findings to clinical applications.

What methodological approaches best support drug discovery targeting mouse 5-HT3A receptors?

Effective drug discovery approaches include:

  • High-throughput screening strategies:

    • Fluorescence-based assays measuring calcium influx

    • Membrane potential dyes to detect channel activation

    • Radioligand binding assays to identify binding site interactions

  • Structure-based drug design:

    • Virtual screening against binding site models

    • Fragment-based approaches to develop novel ligands

    • Structure-activity relationship studies to optimize lead compounds

  • Functional selectivity screening:

    • Identification of biased ligands that selectively affect specific signaling pathways

    • Compounds that modulate rather than simply activate or block receptor function

    • Allosteric modulators that act at sites distinct from the orthosteric binding site

  • In vivo validation approaches:

    • Behavioral testing in wildtype and Htr3a knockout mice

    • Electrophysiological recordings in brain slices or in vivo

    • PET imaging with radiolabeled ligands to confirm target engagement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.