Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse 5-Hydroxytryptamine Receptor 4 (HTR4)

Recombinant Mouse HTR4 is a synthetic version of the endogenous 5-HT4 receptor, a G protein-coupled receptor (GPCR) encoded by the HTR4 gene. It is widely expressed in both the central nervous system (CNS) and peripheral tissues, including the gastrointestinal tract, heart, and adrenal glands, where it modulates neurotransmitter release and cellular signaling . As a recombinant protein, it is engineered to study receptor function, ligand interactions, and therapeutic applications in vitro and in vivo models.

Molecular Structure and Isoforms

HTR4 is a seven-transmembrane domain GPCR with a glycosylated extracellular N-terminus and an intracellular C-terminus . Key structural features include:

CharacteristicDetails
Protein Length428 amino acids
UniProt IDQ13639
Transmembrane Domains7 helices
Isoforms5-HT4a, 5-HT4b, 5-HT4e, 5-HT4f

Isoforms differ in their C-terminal sequences and tissue-specific expression. For example, 5-HT4e and 5-HT4f are enriched in the myenteric plexus of the gut, while 5-HT4a and 5-HT4b dominate in the CNS and submucosal regions . Internalization efficiency varies between isoforms, influencing receptor desensitization and signaling dynamics .

Central Nervous System (CNS)

HTR4 modulates neurotransmitter release (e.g., glutamate, GABA, dopamine) and regulates behaviors such as sleep, locomotion, and thermoregulation . In the prefrontal cortex, it interacts with p11 (S100A10), a calcium-binding protein that enhances HTR4 surface expression and signaling efficacy. This interaction is critical for antidepressant responses, as p11-deficient mice show reduced behavioral efficacy of 5-HT4 agonists .

Peripheral Functions

  • Gastrointestinal Motility: Presynaptic HTR4 receptors in enteric neurons enhance excitatory neurotransmission, promoting gut movement. Agonists like tegaserod increase colonic transit without causing diarrhea .

  • Cardiovascular Homeostasis: Modulates heart rate and blood pressure via interactions with the autonomic nervous system .

Enteric Nervous System Studies

Mouse models demonstrate that 5-HT4 receptors are enriched in submucosal neurons and interstitial cells of Cajal. Agonists (e.g., renzapride) amplify nicotinic cholinergic currents, highlighting their prokinetic effects .

StudyFindingsMethodology
Enteric 5-HT4 FunctionPresynaptic receptors enhance excitatory signalingRT-PCR, in situ hybridization
Tau Pathology in ADAgonists (prucalopride, RS-67333) reduce synaptic tau and improve cognitionPS19 tauopathy mouse model
Antidepressant Effectsp11-dependent surface expression is required for behavioral responsesBAC transgenic mice

Therapeutic Insights

  • Alzheimer’s Disease (AD): Activation of HTR4 reduces tau aggregation and enhances proteasome activity, mitigating synaptic dysfunction. In PS19 mice, 6-week treatment with prucalopride improved nest-building and spatial memory .

  • Gastrointestinal Disorders: DSP-6952, a novel 5-HT4 agonist, enhances colonic motility and inhibits visceral hypersensitivity in rodent models .

Targeted Applications

  1. Neurodegenerative Diseases:

    • AD: HTR4 agonists may delay cognitive decline by reducing tau burden and preserving serotonergic signaling .

  2. Mood Disorders:

    • Depression: p11-HTR4 interaction is pivotal for antidepressant efficacy, suggesting combinatorial therapies targeting both pathways .

  3. Gastrointestinal Disorders:

    • Chronic Constipation: HTR4 agonists improve colonic transit without inducing diarrhea, as shown in DSP-6952 studies .

Table 1: Basic Information on Recombinant Mouse HTR4

ParameterDetails
GeneHTR4
Protein Name5-Hydroxytryptamine receptor 4
Aliases5-HT4, 5-HT-4
Expression TissuesCNS (putamen, caudate nucleus), gut, heart
Interacting Partnersp11, G proteins (Gsα)

Table 2: Key Research Studies

Study FocusKey FindingsCompounds/Models
Gastrointestinal MotilityEnhanced excitatory currents via HTR4 agonistsTegaserod, renzapride
Tau PathologyReduced synaptic tau and improved cognitionPrucalopride, RS-67333
Depressionp11-dependent antidepressant effectsBAC transgenic mice

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Htr4; 5-hydroxytryptamine receptor 4; 5-HT-4; 5-HT4; Serotonin receptor 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDKLDANVSSNEGFRSVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVMPFGAIELVQDIWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSN STWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP QPADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEQVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD TVECGGQWESRCHLTATSPLVAAQPSDT
Uniprot No.

Target Background

Function
This receptor is one of several that bind to 5-hydroxytryptamine (serotonin), a biogenic hormone with roles as a neurotransmitter, hormone, and mitogen. The receptor's activity is regulated by G proteins that stimulate adenylate cyclase.
Gene References Into Functions
  • Prefrontal cortex 5-HT4Rs mediate hypophagia following stress. PMID: 29069597
  • Studies demonstrate that activating 5-HT4 receptors in the murine gastrointestinal tract with prucalopride enhances cholinergic contractions, indicating facilitation of myenteric cholinergic neurotransmission. PMID: 28332745
  • These data suggest that the correlated expression of Slc6a4 and Htr4 likely involves coregulation of genes located on different chromosomes, modulating serotonergic activity in the gut. PMID: 27072889
  • Altered 5-HT4R expression may influence the development of cortical glutamatergic control of the dorsal raphe nucleus. PMID: 28108396
  • Results demonstrate that the absence of 5-HT4 receptors triggers adaptive changes that could maintain emotional states. Moreover, the behavioral and molecular effects of fluoxetine under pathological depression appear to depend critically on 5-HT4 receptors. PMID: 27586007
  • HTR4's role in pulmonary function likely relates to neural innervation and control of breathing. PMID: 28130264
  • The 5-HT4 receptor regulates insulin secretion and is a potential drug target for diabetes treatment. PMID: 27423314
  • Its activation facilitates neurogenesis of injured enteric neurons. (review) PMID: 26658112
  • Findings of altered lung function and increased AHR in Htr4-null mice support a causal relationship between genetic variation in HTR4 and pulmonary function identified in human genome-wide association studies. PMID: 25342126
  • In vivo data using pharmacological and genetic approaches suggest that 5-HT(4) receptors are not involved in bronchial hyperresponsiveness to 5-HT in cigarette smoke-exposed mice. PMID: 24183679
  • A highly conserved motif in the ligand-binding pocket of serotonin receptors is an important participant in ligand binding. PMID: 23378516
  • These results suggest a prominent role of 5-HT(4)R in promoting angiogenesis. PMID: 22903372
  • Endogenous 5-HT exerts a dual role in the pathogenesis of indomethacin-induced intestinal lesions: pro-ulcerogenic action via 5-HT3 receptors and anti-ulcerogenic action via 5-HT4 receptors. PMID: 22699012
  • This review presents that 5HT4 RECEPTOR knockout mice show a correlation between 5-HT firing rate and depressive/resilience phenotypes. PMID: 23089640
  • These results show that prenatal stress and reduced 5-HT levels can alter 5-HT(4)R expression in the developing forebrain and that some 5-HT(4)R splice variants. PMID: 22564922
  • This study demonstrated the expression of alternatively spliced multiple transcripts of 5-hydroxytryptamine receptor in the heart. PMID: 22079627
  • Mucosal 5-HT(4) receptor activation can mediate the prokinetic and antinociceptive actions of 5-HT(4)R agonists. PMID: 22226658
  • G protein activation by serotonin type 4 receptor dimers: evidence that turning on two protomers is more efficient. PMID: 21247891
  • -HT-R splice variants and beta-ARs are differentially regulated in the embryonic telencephalon PMID: 20805681
  • Adaptive changes in cholinergic systems may circumvent the absence of 5-HTR(4) to maintain long-term memory under baseline conditions. PMID: 20209108
  • After bulbectomy, 5-HT(4) receptor binding was increased in the ventral hippocampus but unchanged in the dorsal hippocampus, frontal and caudal caudate putamen. PMID: 20060867
  • These results suggest that during development, 5-HT4-R expression undergoes dynamic regulation, which may be crucial for the normal development of sensory and limbic processing. PMID: 19998416
  • 5-HT4 receptor knockout mice exhibit an attenuated response to stress and increased susceptibility to seizures. PMID: 14724239
  • The mechanisms underlying feeding disorders in 5-HT4 receptor knockout mice are linked to a decreased efficacy of 5-HT (hypothalamus, nucleus accumbens), leptin, and the cocaine-amphetamine related transcript in reducing food intake following stress. PMID: 15146954
  • SNX27 and NHERF specifically interact with the 5-HT4a receptor splice variant. PMID: 15466885
  • The uncoupling and endocytosis of 5-HT4R require different GRK2 concentrations and involve distinct molecular events. PMID: 15919661
  • 5-HT(4a), 5-HT(4b), 5-HT(4e), and 5-HT(4f) isoforms were found in mouse brain and gut. Enteric neuronal 5-HT(4) receptors are thus presynaptic and likely exert their prokinetic effects by strengthening excitatory neurotransmission. PMID: 16037544
  • Results describe the adaptive changes in serotonin neurons of the raphe nuclei in 5-HT(4) receptor knockout mice. PMID: 16930432
  • These and previous data collectively suggest that the 5-HT4 receptor might be an effective therapeutic target for AD, providing both symptomatic improvements and neuroprotection. PMID: 16978609
  • Activation of colonic myenteric neurons in the 5-HT4 receptor-mediated colonic propulsive motor response. PMID: 16990446
  • Data show that 5-HT(4) receptor stimulation in primary neurons produced a potent but transient activation of the ERK pathway that is dependent on Src tyrosine kinase but totally independent of beta-arrestin. PMID: 17377064
  • The serotoninergic 5-HT4 receptor plays a significant role in mouse fetal development. In BALB/c mice, there is a direct relation between its expression and the detrimental effect of maternal anti-5-HT4 receptor autoantibodies in early embryogenesis. PMID: 17445258
  • These findings provide evidence that 5-HT(4)Rs stimulation selectively increases experience-dependent structural plasticity in learning-activated hippocampal circuits. PMID: 18075492
  • The essential role of p11 in modulating signaling through 5-HT4 as well as 5-HT1B receptors supports the concept of p11 protein as a key determinant of vulnerability to depression. PMID: 19211900
  • This is the first demonstration of adult enteric neurogenesis. Our results suggest that 5-HT(4) receptors are required postnatally for enteric nervous system growth and maintenance. PMID: 19657021
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Note=Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli.

Q&A

What is Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4)?

Recombinant Mouse 5-hydroxytryptamine receptor 4 (Htr4) is a laboratory-produced form of the mouse serotonin 4 receptor protein. It is commonly referred to by several names including 5-HT4, 5HTR4, and 5-HT<4L>. This recombinant protein is specifically engineered for research applications investigating serotonergic signaling systems. The protein is typically produced through heterologous expression in various host systems and purified to ≥85% purity as determined by SDS-PAGE analysis .

Functionally, Htr4 belongs to the broader family of serotonin receptors that mediate the effects of the neurotransmitter serotonin (5-hydroxytryptamine). While the search results don't provide specific details about Htr4 function, serotonin receptors generally play crucial roles in neuronal signaling, mood regulation, and various physiological processes.

What expression systems are available for producing Recombinant Mouse Htr4?

Recombinant Mouse Htr4 can be produced in multiple expression systems depending on the research requirements. According to the available data, the following expression systems are commonly employed:

Expression SystemAdvantagesTypical Applications
E. coliCost-effective, high yield, rapid productionBasic binding studies, antibody production
YeastEukaryotic post-translational modifications, secretion capabilityStructural studies, interaction analyses
BaculovirusComplex protein folding, higher-order PTMsFunctional studies requiring proper conformation
Mammalian CellNative-like folding and modifications, appropriate glycosylationSignaling studies, in vitro functional assays

Each expression system offers distinct advantages based on the intended application. Selection should be made based on project requirements for protein folding, post-translational modifications, and functional activity .

How is the quality of Recombinant Mouse Htr4 typically assessed?

Quality assessment of Recombinant Mouse Htr4 involves multiple analytical techniques to ensure protein integrity and functionality:

  • Purity Analysis: SDS-PAGE is the primary method used to determine protein purity, with commercial preparations typically achieving ≥85% purity .

  • Identity Confirmation: While not explicitly mentioned in the search results, Western blotting using specific antibodies would typically be used to confirm protein identity.

  • Functional Testing: Although specific methods for Htr4 are not detailed in the search results, functional assays might include ligand binding assays, signaling pathway activation measurements, or receptor internalization studies.

  • Structural Integrity: Techniques such as circular dichroism spectroscopy might be employed to verify proper protein folding, though this isn't specifically mentioned in the search results.

Researchers should carefully review quality control documentation when selecting recombinant proteins for their experiments to ensure consistency and reproducibility.

What methodological considerations are important when designing experiments with Recombinant Mouse Htr4?

When designing experiments utilizing Recombinant Mouse Htr4, several methodological considerations require attention:

How can researchers effectively validate the functionality of recombinant Htr4 proteins?

Validating the functionality of recombinant Htr4 proteins requires a multi-faceted approach:

  • Ligand Binding Assays: While specific assays for Htr4 aren't detailed in the search results, radioligand binding using selective 5-HT4 ligands would typically be employed to confirm the receptor retains its binding pocket integrity.

  • G-protein Coupling: As a G-protein coupled receptor, Htr4 functionality can be assessed through downstream signaling activation, typically measuring cAMP production since 5-HT4 receptors primarily couple to Gαs proteins.

  • Receptor Trafficking: Fluorescently-tagged Htr4 can be monitored for appropriate subcellular localization and internalization dynamics following agonist exposure.

  • Comparative Analysis: Parallel testing of recombinant Htr4 alongside native receptors in appropriate cellular contexts can provide validation of physiological relevance.

  • Antibody Recognition: Specific antibodies can verify the structural integrity of epitopes, similar to the approach used for human 5-HT4 detection described in the search results .

What strategies can address challenges in expressing functional membrane proteins like Htr4?

Expressing functional serotonin receptors presents several challenges due to their transmembrane nature. Effective strategies include:

  • Expression System Optimization: For Htr4, mammalian expression systems often provide the most functionally relevant protein due to appropriate chaperone proteins and post-translational modification machinery .

  • Fusion Partners: Consider employing fusion tags that enhance expression and folding, such as SUMO or MBP tags, which can be later removed if necessary.

  • Stabilizing Mutations: Introduction of specific mutations that enhance thermostability without affecting function can improve expression yields.

  • Lipid Environment Reconstitution: Purified receptor proteins can be reconstituted into nanodiscs, liposomes, or other membrane mimetics to maintain native-like structure and function.

  • Truncation Strategies: For certain applications, expressing specific domains rather than the full-length receptor may improve yields while preserving the functionality of interest.

How do findings from 5-HT receptor studies in mouse models inform broader serotonergic system research?

Mouse models provide valuable insights into serotonergic system function with several important considerations:

  • Translational Relevance: While mouse and human serotonin receptors share significant homology, species differences exist in pharmacological profiles and tissue distribution. These must be accounted for when extrapolating findings to human physiology.

  • Genetic Manipulation Insights: Studies with knockout mice have revealed critical roles of serotonin signaling in anxiety-related behaviors. For instance, research with 5-HTT knockout mice demonstrated that alterations in serotonergic transmission produce robust phenotypic abnormalities in anxiety tests, which were reversible with selective 5-HT1A receptor antagonists .

  • Compensatory Mechanisms: Genetic manipulations often trigger compensatory changes in other components of the serotonergic system. In 5-HTT knockout mice, prolonged clearance of serotonin leads to nine-fold increases in extracellular serotonin and consequent receptor downregulation .

  • Behavioral Phenotyping: Mouse models with altered serotonin receptor expression provide opportunities to correlate molecular changes with behavioral outcomes using standardized tests such as elevated plus maze, light-dark exploration, and open field tests .

  • Pharmacological Validation: Selective ligands can be used to validate the role of specific receptors in observed phenotypes, as demonstrated with the 5-HT1A antagonist WAY 100635, which produced anxiolytic effects in 5-HTT knockout mice but not in wild-type controls .

What experimental approaches can distinguish the functional contributions of Htr4 from other serotonin receptor subtypes?

Differentiating the functional contributions of Htr4 from other serotonin receptor subtypes requires specialized experimental approaches:

  • Pharmacological Profiling: Employ subtype-selective agonists and antagonists with documented selectivity profiles. For Htr4, compounds like RS-67506 (agonist) and GR-113808 (antagonist) provide reasonable selectivity.

  • Genetic Approaches: Utilize Htr4 knockout mouse models or RNA interference techniques to specifically downregulate Htr4 expression while monitoring for compensatory changes in other receptor subtypes.

  • Biased Signaling Analysis: Different serotonin receptor subtypes couple to distinct G-proteins and signaling pathways. Monitoring pathway-specific outcomes (e.g., cAMP for Gs-coupled Htr4 versus Ca2+ mobilization for Gq-coupled receptors) can help differentiate subtype contributions.

  • Cellular Expression Patterns: Immunohistochemical approaches similar to those described for human 5-HT4 can map the distribution of Htr4 versus other receptor subtypes, informing region-specific functions.

  • Temporal Dynamics: Different receptor subtypes exhibit characteristic desensitization and internalization kinetics. Time-course experiments can help distinguish acute versus sustained signaling contributions.

What detection methods are most effective for Htr4 localization and expression studies?

While the search results don't provide specific information for mouse Htr4 detection, parallel approaches to those used for human 5-HT4 would likely be effective:

  • Immunohistochemistry: Similar to the approach described for human 5-HT4 in brain cortex sections, immunohistochemical staining can visualize Htr4 distribution in mouse tissues. This typically involves specific antibodies, appropriate epitope retrieval techniques, and visualization systems such as HRP-polymer antibodies with DAB staining .

  • Flow Cytometry: For cell populations expressing Htr4, flow cytometric analysis using specific antibodies can quantify receptor expression levels across different experimental conditions .

  • Western Blotting: While not specifically mentioned in the search results, Western blotting would provide quantitative assessment of total Htr4 protein levels in tissue or cell lysates.

  • RT-PCR/qPCR: For transcript-level analysis, reverse transcription followed by PCR or quantitative PCR can measure Htr4 mRNA expression.

  • Radioligand Binding: Tissue-section autoradiography using selective radioligands can map functional receptor distribution with high sensitivity.

How can researchers optimize transfection protocols for studies requiring Htr4 overexpression?

Optimizing transfection protocols for Htr4 overexpression studies requires consideration of several factors:

  • Cell Line Selection: Choose cell lines with low endogenous expression of serotonin receptors to minimize background effects. HEK293 cells are commonly used for serotonin receptor studies, as evidenced by their use in human 5-HT4 research .

  • Construct Design: Include appropriate tags (e.g., fluorescent proteins like eGFP) to monitor transfection efficiency and protein localization without compromising receptor function .

  • Transfection Method Optimization: Compare lipid-based, electroporation, and viral transduction methods to identify optimal conditions for Htr4 expression. Parameters including DNA:transfection reagent ratio, cell density, and post-transfection incubation time should be systematically optimized.

  • Expression Verification: Utilize multiple detection methods to confirm successful expression, including flow cytometry for quantification and microscopy for localization .

  • Functional Validation: Employ functional assays to verify that the overexpressed Htr4 retains signaling capabilities, as structural integrity does not guarantee functionality.

What emerging technologies might advance understanding of Htr4 function in neural circuits?

Several emerging technologies offer promising approaches for investigating Htr4 function in neural circuits:

  • CRISPR-Cas9 Gene Editing: Precise modification of endogenous Htr4 genes to introduce reporter tags or functional mutations can provide insights into receptor dynamics in physiologically relevant contexts.

  • Optogenetic Receptor Control: Development of light-sensitive Htr4 variants would allow temporal control over receptor activation in specific neural populations.

  • Chemogenetic Approaches: Designer Receptors Exclusively Activated by Designer Drugs (DREADDs) based on Htr4 structure could enable selective modulation of Htr4-expressing neurons.

  • Single-Cell Transcriptomics: Analysis of Htr4 expression patterns at single-cell resolution can reveal cell type-specific roles across brain regions and developmental stages.

  • Cryo-EM Structural Studies: High-resolution structural determination of mouse Htr4 in different conformational states would inform structure-based drug design targeting this receptor subtype.

How might comparative studies between serotonin receptor subtypes inform therapeutic development?

Comparative studies across serotonin receptor subtypes can guide therapeutic development through several approaches:

  • Subtype-Selective Pharmacology: Understanding the structural and functional differences between Htr4 and other serotonin receptors can inform the development of highly selective compounds with reduced off-target effects.

  • Signaling Bias Exploitation: Different receptor subtypes exhibit unique signaling profiles. Identifying beneficial signaling pathways specific to Htr4 could lead to biased ligands that selectively activate therapeutic pathways while minimizing unwanted effects.

  • Region-Specific Functions: Mapping the distribution and function of Htr4 compared to other serotonin receptors across brain regions can identify circuit-specific therapeutic opportunities.

  • Developmental Regulation: Comparing the developmental expression patterns of different receptor subtypes may reveal critical periods when Htr4-targeted interventions would be most effective.

  • Translational Models: Building on findings from studies like those with 5-HTT knockout mice , comparative analysis of phenotypes across receptor-specific genetic models can identify the most promising therapeutic targets for specific neuropsychiatric conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.