Recombinant Mouse 5-hydroxytryptamine receptor 5A (Htr5a)

Shipped with Ice Packs
In Stock

Description

Structure and Production of Recombinant Htr5a

Recombinant Htr5a is synthesized using advanced biotechnological methods to ensure functional and structural fidelity.

ParameterDetailsSource
Molecular Weight~40.1 kDa (human ortholog; mouse variant expected to be comparable)
Production SystemsCell-free protein synthesis (CFPS), HEK-293 cells, or wheat germ systems
Purification TagsStrep Tag, DDK (Flag), or Myc tags for affinity chromatography
Purity>70–80% as determined by SDS-PAGE, Western blot, or SEC-HPLC
Storage-80°C in Tris-HCl/glycerol buffer; limited freeze-thaw cycles

Mouse Htr5a is expressed with species-specific sequences aligned with the htr5a gene (NM_008314), which spans 1,074 bp and encodes a multi-pass transmembrane protein . The recombinant protein retains native-like functionality, enabling applications in ligand-binding assays and signal transduction studies .

Functional Characteristics

The 5-HT5A receptor is an inhibitory GPCR that couples to Gi/o proteins, reducing cAMP levels and modulating ion channel activity . Key functional properties include:

Electrophysiological Profile

Mouse Htr5a mediates inwardly rectifying potassium (Kir3) currents, as demonstrated in ex vivo cortical pyramidal neurons .

ParameterValueExperimental SetupSource
Reversal Potential~-98 mV (near K⁺ equilibrium)Brain slice recordings
EC₅₀ for 5-HT0.6–0.9 μM (rats/mice)Concentration-response curves
Antagonist SensitivityBlocked by SB-699551 (10 μM)Cortical neuron studies

Activation of Htr5a suppresses neuronal firing by reducing input resistance and hyperpolarizing membrane potential . Genetic deletion of htr5a in mice paradoxically increases 5-HT1A receptor-mediated currents, suggesting compensatory plasticity .

Applications in Research

Recombinant Htr5a serves as a critical tool for studying serotonin signaling and receptor pharmacology.

Key Applications

  1. Ligand-Binding Assays

    • 5-CT (5-Carboxamidotryptamine): High-affinity agonist (pKi = 7.7 for human 5-HT5A; rodent data inferred) .

    • SB-699551: Selective antagonist used to confirm Htr5a specificity .

  2. Functional Studies

    • G-Protein Coupling: Recombinant Htr5a couples to Gi/o proteins, inhibiting adenylate cyclase and reducing cAMP .

    • Ion Channel Modulation: Activation of Kir3 channels in neuronal membranes .

  3. Antibody Production

    • Native antigen for generating anti-Htr5a antibodies for Western blot or immunohistochemistry .

Behavioral and Neurophysiological Roles

  • Exploratory Behavior: Htr5a knockout mice exhibit increased novelty-seeking behavior, suggesting a role in regulating anxiety-like responses .

  • Cortical Plasticity: Htr5a-rich layer V pyramidal neurons exhibit distinct firing patterns, with 73% of "initial-doublet" neurons responsive to 5-HT5A agonists .

Species-Specific Differences

ParameterHuman 5-HT5AMouse 5-HT5A
pKi for 5-CT7.7 (20 nM Ki)7.8–7.9 (15–25 nM Ki)
Receptor SubtypeFunctionalFunctional

Unlike humans, mice express both 5-HT5A and 5-HT5B receptors, but the latter is non-functional in humans due to pseudogenization .

Table 1: Pharmacological Profile of 5-HT5A Receptors

LigandSpeciesBinding Affinity (pKi)Assay TypeSource
5-CTHuman7.7 (20 nM Ki)[³H]-5-CT displacement
5-CTMouse7.8–7.9Radioligand binding
SB-699551Mouse7.7 (10 μM IC₅₀)Electrophysiology

Table 2: Electrophysiological Properties of Htr5a

ParameterValueExperimental ModelSource
Reversal Potential-98 mVCortical layer V neurons
EC₅₀ (5-HT)0.6–0.9 μMBrain slice recordings
Current Amplitude14–17 pAVoltage-clamp recordings

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Htr5a; 5ht5a; 5-hydroxytryptamine receptor 5A; 5-HT-5; 5-HT-5A; 5-HT5A; Serotonin receptor 5A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDLPVNLTSFSLSTPSSLEPNRSLDTEVLRPSRPFLSAFRVLVLTLLGFLAAATFTWNLL VLATILKVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHLEYTLRTRKRVSNVMILLTWALSTVISLAPLLFG WGETYSEPSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTNSVS PVPEAVEVKNATQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP FFVTELISPLCSWDVPAIWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
Uniprot No.

Target Background

Function
This receptor is one of several that bind to 5-hydroxytryptamine (serotonin), a biogenic hormone with diverse roles as a neurotransmitter, hormone, and mitogen. The receptor's activity is mediated by G proteins.
Gene References Into Functions
  1. This study demonstrated that loss of the htr5A gene significantly upregulates 5-HT1A receptor-mediated currents in the prefrontal cortex. PMID: 22539842
Database Links

KEGG: mmu:15563

STRING: 10090.ENSMUSP00000038884

UniGene: Mm.4835

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in the central nervous system; in the cerebral cortex, hippocampus, habenula, olfactory bulb and granular layer of the cerebellum.

Q&A

What are the key differences between mouse and human 5-HT5A receptors?

The mouse 5-HT5A receptor shows similar pharmacological profiles to human 5-HT5A, responding to non-selective agonists like 5-carboxamidotryptamine (5-CT) . Methodologically, when designing experiments using recombinant mouse 5-HT5A, researchers should account for potential cross-reactivity with 5-HT5B receptors, which doesn't occur in human tissue.

How can researchers effectively express and characterize recombinant mouse 5-HT5A receptors?

Expression of recombinant mouse 5-HT5A receptors typically employs heterologous expression systems such as HEK-293 cells, similar to approaches used for human 5-HT5A . The methodology involves:

  • Cloning the mouse Htr5a gene from cDNA libraries derived from mouse brain tissue

  • Insertion into appropriate expression vectors with strong promoters (e.g., CMV)

  • Transfection into mammalian cell lines (HEK-293 cells have demonstrated successful expression of related 5-HT receptors)

  • Selection of stable transfectants using appropriate antibiotic resistance markers

  • Confirmation of expression through radioligand binding assays using [³H]-labeled ligands with known affinity for 5-HT5A receptors

Functional characterization can be performed using assays that measure G-protein activation, such as [³⁵S]-GTPγS binding assays, which have successfully demonstrated dose-dependent responses with the human receptor . Additionally, measuring inhibition of forskolin-stimulated cAMP accumulation can confirm Gi-protein coupling and functionality .

What are the recommended methods for measuring 5-HT5A receptor activity in mouse models?

For measuring 5-HT5A receptor activity in mouse models, researchers can employ several complementary approaches:

In vitro methods:

  • Radioligand binding assays using membrane preparations from mouse brain regions with high 5-HT5A expression

  • [³⁵S]-GTPγS binding assays to measure G-protein activation following receptor stimulation

  • cAMP inhibition assays to quantify the receptor's negative influence on adenylyl cyclase activity

  • Calcium mobilization assays to measure changes in intracellular Ca²⁺ following receptor activation

Ex vivo/in vivo methods:

  • Electrophysiological recordings in brain slices to measure neural activity changes

  • In vivo microdialysis to measure neurotransmitter release in response to 5-HT5A modulation

  • Behavioral assays focusing on memory, nociception, and anxiety-related phenotypes, which have been linked to 5-HT5A function

Due to limited selective ligands for 5-HT5A receptors, researchers often use non-selective agonists like 5-CT in combination with antagonists for other 5-HT receptor subtypes to isolate 5-HT5A-mediated responses .

How do genetic modifications of the mouse Htr5a gene affect serotonergic signaling pathways?

Genetic modifications of the mouse Htr5a gene can significantly impact serotonergic signaling through complex compensatory mechanisms. When designing Htr5a knockout or knockdown models, researchers should consider:

  • Compensatory changes in other 5-HT receptor expressions: Unlike single 5-HT1A receptor knockouts which show clear anxiety phenotypes , Htr5a modifications may lead to compensatory upregulation of other inhibitory serotonin receptors, particularly 5-HT1 family receptors which share G-protein coupling mechanisms .

  • Altered signal transduction pathways: Genetic inactivation of Htr5a likely affects multiple downstream signaling components, including:

    • cAMP-dependent protein kinase A (PKA) nuclear localization and activity

    • Calcium signaling dynamics, as 5-HT5A regulates intracellular calcium mobilization

    • Potential changes in GABA/glutamate balance similar to those observed in 5-HT1A knockout mice

  • Regional variations in effects: The impact of Htr5a modification varies by brain region, with likely pronounced effects in areas with high 5-HT5A expression such as cerebral cortex, hippocampus, and cerebellum.

Methodologically, researchers should employ comprehensive approaches including biochemical assays measuring various second messengers (cAMP, Ca²⁺), protein phosphorylation states, and electrophysiological recordings across multiple brain regions to fully characterize the impact of Htr5a genetic modifications.

What experimental approaches can differentiate between 5-HT5A and 5-HT5B receptor functions in mouse models?

Differentiating between 5-HT5A and 5-HT5B receptor functions in mice presents a significant challenge due to their structural similarities and limited availability of selective ligands. Recommended experimental approaches include:

Genetic approaches:

  • Generation of receptor subtype-specific knockout mice (Htr5a⁻/⁻ vs. Htr5b⁻/⁻)

  • RNA interference targeting subtype-specific sequences

  • CRISPR/Cas9 gene editing to introduce subtype-specific mutations

Pharmacological approaches:

  • Combined use of non-selective agonists with selective antagonists for other 5-HT receptors

  • Dose-response studies exploiting potential differences in ligand affinities

  • Development of subtype-selective antibodies for immunoprecipitation or immunoneutralization studies

Expression analysis approaches:

  • In situ hybridization with subtype-specific probes to map differential expression patterns

  • Single-cell RNA sequencing to identify cell populations expressing each subtype

  • Quantitative PCR to measure relative expression levels across tissues

An effective methodological strategy combines these approaches, for example, by conducting pharmacological studies in both wild-type and subtype-specific knockout mice, allowing researchers to attribute observed effects to specific receptor subtypes.

What are the critical parameters for successful functional coupling studies with recombinant mouse 5-HT5A?

Successful functional coupling studies with recombinant mouse 5-HT5A require careful optimization of several critical parameters:

Cell system selection:

  • HEK-293 cells have demonstrated successful expression and coupling of human 5-HT5A to G-proteins and represent a suitable system for mouse 5-HT5A

  • Expression levels must be carefully controlled as over-expression may lead to constitutive activity or coupling to non-physiological G-protein subtypes

Assay conditions:

  • Buffer composition, particularly divalent cation concentrations (Mg²⁺, Ca²⁺), significantly affects G-protein coupling efficiency

  • Temperature and incubation times for [³⁵S]-GTPγS binding assays typically require optimization (generally 25-30°C for 30-60 minutes)

  • For cAMP inhibition assays, forskolin concentration should be titrated to produce submaximal adenylyl cyclase stimulation

G-protein subtype analysis:

  • Selective G-protein inhibitors (e.g., pertussis toxin for Gi/o) help confirm specific coupling pathways

  • Co-immunoprecipitation studies with antibodies against specific G-protein α-subunits can identify precise coupling partners

  • BRET/FRET approaches can directly measure receptor-G-protein interactions in real-time

To establish reproducible assays, researchers should conduct comprehensive concentration-response studies with reference compounds like 5-CT, which has demonstrated dose-dependent effects on G-protein activation and cAMP inhibition via the human 5-HT5A receptor .

How should researchers address the lack of selective ligands for mouse 5-HT5A receptor studies?

The scarcity of selective ligands for the 5-HT5A receptor presents a significant challenge for researchers. To overcome this limitation, several methodological approaches are recommended:

Combined pharmacological approach:

  • Use non-selective agonists like 5-carboxamidotryptamine (5-CT) in combination with selective antagonists for other 5-HT receptor subtypes (particularly 5-HT1A, 5-HT1B, 5-HT1D, and 5-HT7)

  • Implement a systematic subtraction method where responses in the presence of various antagonist combinations help isolate 5-HT5A-specific effects

Genetic tools:

  • Utilize 5-HT5A knockout models as negative controls to confirm receptor specificity

  • Employ knockdown approaches (siRNA, shRNA) in cell systems and tissue preparations

  • Consider receptor overexpression systems to amplify 5-HT5A-mediated responses

Structure-based drug design:

  • Iterative molecular docking approaches guided by the 5-HT5A receptor structure can identify potential selective compounds

  • High-throughput screening of compound libraries followed by medicinal chemistry optimization

  • Focus on compounds that exploit structural differences between 5-HT5A and other 5-HT receptors

A rigorous methodological approach would combine these strategies, with special attention to appropriate controls that can distinguish 5-HT5A-mediated effects from those of other serotonin receptors.

What techniques are most effective for studying 5-HT5A receptor expression patterns in the mouse brain?

For comprehensive characterization of 5-HT5A receptor expression patterns in the mouse brain, researchers should employ multiple complementary techniques:

mRNA detection methods:

  • In situ hybridization with receptor subtype-specific riboprobes

  • RNAscope for high-sensitivity detection with cellular resolution

  • Quantitative RT-PCR for relative expression quantification across brain regions

  • Single-cell RNA sequencing to identify specific neuronal populations expressing 5-HT5A

Protein detection methods:

  • Immunohistochemistry using validated 5-HT5A-specific antibodies (with knockout tissue as negative controls)

  • Western blotting for semi-quantitative protein expression analysis

  • Autoradiography with radiolabeled ligands (with appropriate displacement controls)

  • Proximity ligation assays to detect 5-HT5A interactions with signaling partners

Reporter systems:

  • Transgenic mice expressing fluorescent proteins under the Htr5a promoter

  • Viral vectors carrying fluorescent reporters driven by the Htr5a promoter

A methodological challenge is ensuring specificity, as antibodies against G-protein coupled receptors often show cross-reactivity. Researchers should validate antibodies using knockout tissues or heterologous expression systems before conducting extensive expression studies.

What are the best practices for designing experiments to investigate 5-HT5A receptor involvement in complex behaviors?

Investigating 5-HT5A receptor involvement in complex behaviors requires careful experimental design considering multiple factors:

Genetic approaches:

  • Conditional and inducible 5-HT5A knockout models to control temporal and spatial receptor deletion

  • Region-specific knockdown using viral vectors carrying shRNA against Htr5a

  • Behavioral testing of constitutive knockout models with appropriate controls for developmental compensation

Pharmacological strategies:

  • Local microinjection of 5-HT5A ligands into specific brain regions

  • Systemic administration of available 5-HT5A-preferring compounds with appropriate controls

  • Combinatorial pharmacology using 5-HT5A ligands with antagonists of interacting neurotransmitter systems

Behavioral testing paradigms:

  • Based on existing evidence, focus on behavioral tests assessing:

    • Memory stabilization and retention processes

    • Pain sensitivity and nociceptive processing

    • Potential roles in anxiety-related behaviors (similar to other 5-HT receptors)

    • Response to chronic SSRI treatment (given the receptor's reported role in antidepressant efficacy)

Integrated approaches:

  • Combine behavioral testing with in vivo electrophysiology or calcium imaging

  • Utilize optogenetic or chemogenetic manipulation of neurons expressing 5-HT5A

  • Correlate behavioral outcomes with molecular and cellular changes in brain tissue

Researchers should design experiments with appropriate controls for factors like genetic background, which has been shown to significantly impact phenotypes in 5-HT receptor knockout models .

How do research findings from recombinant mouse 5-HT5A systems compare to native receptor studies?

Recombinant expression systems and native tissue studies each offer distinct advantages and limitations when investigating 5-HT5A receptors:

Comparative aspects:

ParameterRecombinant SystemsNative Tissue Studies
Expression levelHigh, controllablePhysiological, region-dependent
Signal-to-noise ratioTypically higherOften lower, requires sensitive methods
G-protein couplingMay couple to available G-proteinsPhysiological coupling only
Receptor interactionsLimited interacting partnersComplete native interaction network
Pharmacological profileMay differ from native receptorsReflects physiological conditions
Experimental controlHigh standardizationHigher biological relevance

When working with recombinant mouse 5-HT5A receptors, researchers should validate key findings in native tissue preparations. Conversely, mechanistic insights gained from recombinant systems can guide hypothesis testing in more complex native environments.

What challenges arise when translating mouse 5-HT5A research findings to human applications?

Translating mouse 5-HT5A research to human applications presents several important challenges:

Species-specific differences:

  • Unlike humans, mice express both functional 5-HT5A and 5-HT5B receptors

  • Potential differences in expression patterns, signaling pathways, and physiological roles

  • Variations in pharmacological responses and ligand affinities between species

Methodological considerations:

  • Human tissue availability limitations restrict comparative native receptor studies

  • Most human studies rely on post-mortem tissue, complicating interpretation of receptor status

  • Recombinant systems may not fully recapitulate the native receptor environment

Translational strategies:

  • Compare mouse and human recombinant receptors in identical expression systems

  • Develop humanized mouse models expressing human 5-HT5A receptors

  • Validate key mouse findings in human-derived cell lines, induced pluripotent stem cells, or brain organoids

  • Employ computational approaches to model species differences in receptor structure and function

Considering the reported role of 5-HT5A receptors in memory stabilization , researchers should be particularly cautious when extrapolating cognitive findings from mouse models to humans, as cognitive processes have significant species-specific components.

How can researchers integrate 5-HT5A receptor studies with broader serotonergic system investigations?

Integrating 5-HT5A receptor studies into broader serotonergic system research requires multifaceted approaches:

System-level integration strategies:

  • Investigate 5-HT5A receptor co-expression with other serotonin receptors and transporters

  • Study potential heterodimerization with other G-protein coupled receptors

  • Examine 5-HT5A receptor function in the context of serotonergic tone modulation

  • Assess interactions between 5-HT5A and other neurotransmitter systems (particularly GABA and glutamate)

Multidisciplinary methodological approaches:

  • Combine electrophysiological studies of 5-HT5A-expressing neurons with behavioral analysis

  • Utilize chemogenetic or optogenetic tools to selectively activate 5-HT5A-expressing cells within serotonergic circuits

  • Implement circuit-mapping techniques to understand 5-HT5A's position in neural networks

  • Apply systems biology approaches to model 5-HT5A's role in complex serotonergic signaling networks

Translational integration:

  • Connect 5-HT5A findings with clinical observations in disorders with serotonergic involvement

  • Examine 5-HT5A receptor function in models of serotonergic drug action (e.g., SSRIs, psychedelics)

  • Investigate potential interactions between 5-HT5A and genetic risk factors for neuropsychiatric disorders

The 5-HT5A receptor's reported role in SSRI antidepressant efficacy provides a particularly relevant connection point between basic receptor mechanisms and clinical applications, warranting detailed investigation of how 5-HT5A function changes during chronic SSRI treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.