Recombinant Mouse 5-hydroxytryptamine receptor 6 (Htr6)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Definition:
Recombinant Mouse Htr6 refers to the in vitro expression of the mouse 5-HT6 receptor using engineered systems (e.g., E. coli or mammalian cells) to produce functional or structural forms for biochemical, pharmacological, or cellular studies .

Signaling Mechanism:

  • Coupled to Gs proteins, leading to adenylate cyclase activation and cAMP production .

  • Modulates mTORC1 signaling, impacting dendritic spine density and synaptic plasticity .

Key Findings from Studies:

  • Neuronal Morphology:

    • Htr6 knockout (KO) mice exhibit reduced dendritic complexity in hippocampal CA1 pyramidal neurons and dentate gyrus granule cells .

    • Rescue experiments via hippocampal Htr6-GFP transfection restore synaptic plasticity and spatial memory deficits .

  • Cognitive Deficits:

    • Htr6 KO mice show impaired long-term potentiation (LTP) and spatial memory, reversible upon receptor reintroduction .

    • Htr6 agonists (e.g., WAY-181187) enhance cAMP signaling and improve cognitive performance in preclinical models .

  • Constitutive Activity:

    • Structural studies reveal that Htr6 exhibits high basal Gs-coupling activity, driven by interactions between TM6/TM7 helices and Gαs residues (e.g., R325 and R389) .

Role in Neurological Pathways

  • mTORC1 Regulation:

    • Htr6 activation stimulates mTORC1, promoting dendritic spine maturation and synaptic efficacy .

    • Dietary restriction (DR) downregulates Htr6 expression, reducing mTORC1 activity and enhancing hippocampal plasticity .

  • Primary Cilia Signaling:

    • Htr6 localizes to neuronal primary cilia and interacts with Sonic Hedgehog (Shh) pathways, influencing neuronal excitability and ciliogenesis .

Pharmacological and Therapeutic Relevance

  • Ligand Interactions:

    • High affinity for tricyclic antidepressants and atypical antipsychotics .

    • Antagonists (e.g., SB-271046) reverse scopolamine-induced cognitive deficits, highlighting therapeutic potential for Alzheimer’s disease .

  • Dynamic Protein Partners:

    • Sequential interactions with Cdk5 and GPRIN1 regulate neurite outgrowth and cAMP signaling .

Technical Considerations for Experimental Use

  • Antibody Validation:

    • Commercial antibodies (e.g., CSB-PA009366) show cross-reactivity with human, mouse, and rat Htr6 .

    • Recombinant proteins are validated for use in ELISA, Western blotting, and immunohistochemistry .

  • Expression Challenges:

    • Constitutive activity necessitates careful assay design to distinguish basal vs. ligand-induced signaling .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize its development for your product.
Synonyms
Htr6; 5-hydroxytryptamine receptor 6; 5-HT-6; 5-HT6; Serotonin receptor 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF FVTDSVEPEIRQHPLGSPMN
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 6 (Htr6) is one of several receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, hormone, and mitogen. This receptor's activity is mediated by G proteins that stimulate adenylate cyclase. Htr6 exhibits a high affinity for tricyclic psychotropic drugs. Notably, it controls pyramidal neuron migration during corticogenesis by regulating CDK5 activity and acts as an activator of TOR signaling.
Gene References Into Functions
  1. High 5-HT6R expression is associated with delayed bone development and regeneration. PMID: 27581523
  2. This study suggests that 5-HT6 plays a crucial role in Alzheimer's disease development through regulating the morphology and function of neuronal primary cilia, which may be related to the AIS and axon alterations observed in Alzheimer's disease development. PMID: 28931427
  3. These findings suggest that disrupting 5-HT6 receptor-neurofibromin interaction prevents agonist-independent 5-HT6 receptor-operated cAMP signaling in the prefrontal cortex, potentially contributing to neuronal abnormalities in NF1 patients. PMID: 27791021
  4. Results highlight the role of 5-HT6 receptor signaling in primary cilia morphology, suggesting that future research should consider relative levels of receptor expression when evaluating their impact on primary cilia function. PMID: 28087224
  5. The 5-HT6/7 receptor antagonist ADN-1184 demonstrates anxiolytic-like activity in animal models of anxiety employing punished stimuli. PMID: 26979176
  6. SNX14 acts as a dual endogenous negative regulator in the 5-HT6R-mediated signaling pathway. PMID: 25795301
  7. Knockdown of MAO-A expression in embryos induces high serotonin levels and abnormal brain development, which can be rescued by inactivation of the serotonin receptor-6. PMID: 24497636
  8. Coexpression of 5HT6 with adenylyl cyclase type III normalizes cilia structure and restores dendrite outgrowth. PMID: 23392690
  9. Serotonergic stimulation of 5-HT6 serotonin receptors enhances extrapyramidal motor symptoms; antagonism of 5-HT6 receptors alleviates these symptoms. PMID: 20813116
  10. 5-HT6 receptors were expressed in embryonic mouse cortical interneurons, and activation of the 5-HT6 receptor decreased interneuron migration, while 5-HT6 receptor blockade prevented the migratory effects induced by 5-HT. PMID: 18663366

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mouse 5-hydroxytryptamine receptor 6 (Htr6) and how does it function?

The 5-hydroxytryptamine receptor 6 (Htr6) is a G-protein-coupled receptor that is encoded by the Htr6 gene in mice. It functions as a receptor for serotonin (5-hydroxytryptamine), a biogenic hormone that acts as a neurotransmitter, hormone, and mitogen. Htr6 receptor activity is mediated by G proteins that stimulate adenylate cyclase to increase cAMP levels within neurons . In the central nervous system, Htr6 plays crucial roles in regulating neuronal development, particularly during corticogenesis where it controls pyramidal neuron migration through CDK5 activity regulation . Additionally, Htr6 is an activator of the TOR (Target of Rapamycin) signaling pathway, which has significant implications for neuronal plasticity and memory formation .

Where is Htr6 primarily expressed in the mouse brain?

In mice, Htr6 expression is more restricted compared to rats and humans. It is predominantly expressed in several brain regions including:

  • Caudate-putamen and nucleus accumbens

  • Hippocampus (particularly in the CA1 region and dentate gyrus)

  • Cerebral cortex

  • Olfactory tubercle

  • Amygdala

At the cellular level, Htr6 shows a unique and specific localization to primary cilia of pyramidal neurons, making it a valuable marker for these specialized neuronal structures . This ciliary localization is particularly significant as approximately 35% of these ciliated structures form close appositions with serotonergic axons, suggesting specialized signaling microdomains .

How does Htr6 expression change during development?

Htr6 is expressed earlier in brain development than most other serotonin receptors. In rats (which show similar developmental patterns to mice), high levels of 5-HT6 receptors are first expressed on embryonic day 12 (E12), with a slight decrease around E17, after which expression remains relatively stable through to adulthood . This expression pattern coincides with the emergence of serotonergic neurons, suggesting Htr6 plays an important role in early neuronal development within the serotonergic system .

How does Htr6 modulate synaptic plasticity and memory formation?

Htr6 plays a critical role in modulating synaptic plasticity and memory formation through several mechanisms:

  • Regulation of mTORC1 signaling: Research demonstrates that Htr6 functions upstream of mechanistic target of rapamycin complex 1 (mTORC1) signaling, a pathway that couples nutrient sensing to memory performance. Under dietary restriction conditions, Htr6 expression decreases, leading to enhanced memory performance through modulation of this pathway .

  • Effects on neuronal morphology: Htr6 influences dendritic complexity and spine density in hippocampal neurons. When Htr6 activity is reduced (either through dietary restriction or genetic knockout), neurons exhibit decreased dendritic complexity but increased spine density, particularly in CA1 pyramidal neurons and dentate gyrus granule cells .

  • Long-term potentiation enhancement: Htr6 knockout mice exhibit enhanced long-term potentiation (LTP) in hippocampal neurons, similar to effects observed with dietary restriction. When Htr6 is reintroduced into knockout mice through targeted expression of Htr6-GFP in the CA1 region, LTP levels return to normal, confirming Htr6's direct role in synaptic plasticity regulation .

These mechanisms suggest that Htr6 serves as a regulatory checkpoint for memory formation, with reduced Htr6 signaling generally enhancing memory performance.

What phenotypes are observed in Htr6 knockout mice?

Htr6 knockout (KO) mice display several distinctive phenotypes that highlight the receptor's physiological roles:

  • Enhanced memory performance: Htr6 KO mice exhibit improved memory in novel object recognition tests under both ad libitum and dietary restriction conditions, suggesting Htr6 normally constrains certain aspects of memory formation .

  • Altered responses to ethanol: Htr6 KO mice show decreased sensitivity to ethanol-induced ataxia and sedation, alongside increased ethanol-induced locomotor activity in open field tests. These responses occur without alterations in ethanol metabolism, implicating Htr6 in the serotonergic modulation of ethanol responses .

  • Neuroanatomical changes: Similar to dietary restricted mice, Htr6 KO mice display decreased dendritic complexity but increased spine density in hippocampal neurons, suggesting fundamental alterations in neuronal architecture .

  • Enhanced synaptic plasticity: Htr6 KO mice demonstrate higher magnitude long-term potentiation in hippocampal slice recordings, indicating enhanced synaptic strengthening capabilities .

Interestingly, despite these significant alterations in memory and response to substances, Htr6 KO mice show no perturbations in baseline behavior across a wide array of neurobehavioral assays, suggesting compensatory mechanisms may exist for normal behavioral function .

How does Htr6 interact with the serotonergic system at the synaptic level?

Recent research has uncovered a specialized interaction between Htr6 receptors and the serotonergic system at the subcellular level:

  • Axo-ciliary synapses: Super-resolution microscopy has revealed that approximately 35% of neuronal primary cilia containing Htr6 form close appositions with serotonergic axons, as identified by serotonin transporter (SERT) labeling .

  • Synaptophysin colocalization: All axonal sites opposing Htr6-positive cilia contain synaptophysin staining, suggesting these are functional serotonin release sites forming specialized axo-ciliary synapses .

  • Ciliary serotonin sensing: Researchers have developed ciliary-targeted serotonin sensors based on the GPCR-activation-based (GRAB) strategy using Htr6 as a scaffold. These sensors can detect serotonin with an EC50 of approximately 28 nM and show up to 40% fluorescence increase per cilium in response to saturating serotonin doses .

These findings indicate that Htr6 participates in a specialized subcellular signaling domain, where serotonergic axons form synaptic connections directly with neuronal cilia expressing Htr6, potentially creating a unique serotonergic signaling microenvironment.

What models and tools are available for studying Htr6 function?

Several experimental models and molecular tools are available for investigating Htr6 function:

  • Genetic models:

    • Htr6 knockout mice with confirmed absence of Htr6 transcript and protein

    • EGFP knock-in mouse lines allowing visualization of Htr6 expression patterns

  • Molecular reagents:

    Reagent TypeExamplesApplications
    AntibodiesAnti-Htr6 antibodies for various speciesWestern blot, ELISA, IHC
    Recombinant proteinsRecombinant Mouse Htr6 (various expression systems)Binding assays, antibody validation
    Expression constructsHtr6-GFP fusion proteinsRescue experiments, localization studies
    Fluorescent sensorsGRAB-HTR6-PM serotonin sensorsReal-time serotonin detection
  • Pharmacological tools:

    • Selective Htr6 agonists (showing antidepressant effects in rodent models)

    • Selective Htr6 antagonists (enhancing memory performance)

These tools enable multifaceted approaches to Htr6 research, from genetic manipulation to real-time monitoring of receptor function in various experimental contexts .

How can researchers effectively design experiments to study Htr6 signaling in neuronal cilia?

Studying Htr6 signaling in neuronal cilia requires specialized approaches due to the unique localization and signaling properties of this receptor:

  • Ciliary visualization techniques:

    • Use of Htr6-GFP fusion proteins which naturally target to primary cilia

    • Combination with ciliary markers (e.g., Arl13b) for confirmation of ciliary localization

    • Super-resolution microscopy (e.g., Airyscan confocal) to resolve the small ciliary structures

  • Functional ciliary serotonin sensing:

    • Implementation of ciliary-targeted serotonin sensors such as GRAB-HTR6-PM with HaloTag for visualization with bright Janelia Fluor dyes

    • 3D Airyscan imaging for detecting fluorescence changes in individual cilia

    • Calibration with known serotonin concentrations (EC50 for ciliary sensors ≈ 28 nM)

  • Axo-ciliary synapse characterization:

    • Co-labeling for serotonin transporter (SERT) and synaptophysin to identify synaptic connections with cilia

    • Ultrastructural analysis to confirm synaptic morphology

    • Optogenetic stimulation of serotonergic neurons while monitoring ciliary serotonin sensors to assess functional connectivity

  • Signal transduction analysis:

    • Measurement of cAMP production in response to serotonin using ciliary-targeted cAMP sensors

    • Examination of downstream signaling components like mTORC1 pathway activation

    • Use of selective Htr6 agonists and antagonists to verify receptor specificity

These approaches allow for comprehensive investigation of the specialized signaling occurring at axo-ciliary synapses mediated by Htr6 receptors .

How should researchers interpret conflicting data regarding Htr6 function across different species?

Interpreting cross-species variations in Htr6 function requires careful consideration of several factors:

  • Expression pattern differences:

    • Humans and rats show widespread brain Htr6 expression

    • Mice exhibit relatively low Htr6 expression compared to rats and humans

    • These differences may explain why Htr6 antagonists that enhance cognition in rats have minimal effects in mice

  • Sequence homology considerations:

    • Human and rat Htr6 share 89% sequence homology

    • Mouse Htr6 has sufficient differences that may affect ligand binding properties and signaling outcomes

    • Researchers should consider species-specific pharmacology when interpreting drug response data

  • Experimental design adjustments:

    • Use higher drug doses in mice to compensate for potential affinity differences

    • Include positive controls specific to each species

    • Complement pharmacological approaches with genetic models that are less affected by species differences

  • Data integration strategies:

    • When contradictions occur, prioritize data from genetic models over pharmacological studies

    • Consider developmental differences in Htr6 expression patterns between species

    • Evaluate cellular distribution patterns alongside whole-brain expression levels

To address these challenges, researchers should explicitly state the species being studied, avoid direct cross-species extrapolations without validation, and consider using humanized mouse models for translational studies .

How do dietary interventions affect Htr6 expression and function in the context of memory studies?

Dietary restriction (DR) has significant effects on Htr6 expression and function that impact memory performance:

  • Expression changes under DR:

    • DR significantly down-regulates Htr6 mRNA and protein expression in the hippocampus and prefrontal cortex

    • These changes are accompanied by reduced serotonergic activity, indicated by a lower 5-HIAA/5-HT ratio in the hippocampus

    • The mechanism likely involves elevated circulating corticosterone levels under DR conditions

  • Functional consequences:

    • DR-induced down-regulation of Htr6 correlates with enhanced memory performance

    • Administration of Htr6 agonists abrogates DR-induced memory enhancement

    • Htr6 antagonists improve memory in ad libitum fed mice but do not further enhance memory in DR mice, suggesting a common mechanism

  • Neuronal morphology alterations:

    • Both DR and Htr6 knockout reduce dendritic complexity while increasing spine density in hippocampal neurons

    • These structural changes are associated with enhanced long-term potentiation

    • DR does not further enhance these effects in Htr6 KO mice, indicating Htr6 acts downstream of DR

  • Mechanistic pathway:

    ConditionHtr6 ExpressionmTORC1 SignalingMemory Performance
    Ad libitumNormal (high)HighBaseline
    Dietary restrictionReducedReducedEnhanced
    Htr6 KOAbsentReducedEnhanced
    DR + Htr6 KOAbsentReducedEnhanced (no additive effect)

These findings suggest that Htr6 functions as a nutrient sensor in hippocampal neurons, coupling dietary intake to memory performance through modulation of mTORC1 signaling. This pathway represents a potential target for cognitive enhancement strategies that mimic the beneficial effects of dietary restriction .

What considerations should researchers take into account when using recombinant mouse Htr6 for binding and functional studies?

When using recombinant mouse Htr6 for experimental studies, researchers should consider several important factors:

  • Expression system selection:
    Different expression systems yield recombinant Htr6 with varying properties:

    Expression SystemAdvantagesLimitationsBest Applications
    E. coliHigh yield, cost-effectiveLacks post-translational modificationsBinding studies, antibody production
    YeastSome post-translational modificationsGlycosylation patterns differ from mammalsStructural studies
    BaculovirusMore mammalian-like modificationsHigher cost, lower yieldFunctional assays
    Mammalian cellsNative-like receptor propertiesHighest cost, technical complexitySignaling studies, drug screening
  • Protein structure considerations:

    • Full-length vs. partial constructs: Some commercial recombinant Htr6 proteins only contain partial sequences which may affect binding properties

    • N-terminal modifications: Since the N-terminus faces the extracellular space, modifications here may alter ligand binding

    • C-terminal tags: As Htr6 signals through G-proteins that interact with the C-terminus, tags in this region may affect downstream signaling

  • Functional validation approaches:

    • cAMP assays to confirm Gαs coupling and signal transduction

    • Binding assays with known ligands (EC50 for serotonin is approximately 28-84 nM)

    • Ciliary trafficking assessment when used in cellular contexts

    • Verification of species-specific pharmacology, as mouse Htr6 may respond differently to ligands compared to rat or human orthologs

  • Technical considerations for experimental design:

    • Storage conditions: Maintain receptor conformational integrity

    • Buffer composition: Include stabilizing agents to preserve activity

    • Reconstitution into lipid environments for functional studies

    • Control for receptor density when comparing different ligands or conditions

By carefully considering these factors, researchers can optimize the reliability and translational relevance of studies using recombinant mouse Htr6 .

How do findings from mouse Htr6 studies translate to human applications in cognitive disorders?

Translating Htr6 research from mice to humans requires careful consideration of several factors:

  • Species differences:

    • Despite shared functional roles, mouse Htr6 exhibits lower expression levels compared to humans

    • Human HTR6 is more widely expressed throughout the brain than mouse Htr6

    • The human HTR6 gene has 89% sequence homology with rat Htr6, but the exact homology with mouse Htr6 requires consideration when translating findings

  • Cognitive implications:

    • Both mouse and human studies support Htr6 antagonism as procognitive

    • Htr6 knockout mice show enhanced memory performance, suggesting relevance to human cognitive enhancement strategies

    • The mTORC1 pathway regulated by Htr6 is conserved across species and represents a translatable mechanism for cognitive modulation

  • Methodological bridge strategies:

    • Use of comparative studies across mouse, rat, and human tissues

    • Implementation of human HTR6 knock-in mouse models

    • Validation in human-derived neuronal cultures or brain organoids

  • Clinical correlation considerations:

    • Focus on conserved brain regions expressing Htr6 (hippocampus, cortex)

    • Consider ciliary localization as a specialized signaling domain across species

    • Evaluate aging-related changes in Htr6 expression and function as relevant to age-related cognitive decline

The combination of genetic knockout studies in mice, pharmacological manipulations, and understanding of the cellular signaling pathways provides a foundation for developing Htr6-targeted therapies for human cognitive disorders, despite the species differences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.