Recombinant Mouse 5-hydroxytryptamine receptor 7 (Htr7)

Shipped with Ice Packs
In Stock

Description

Core Signaling Pathways

The 5-HT7 receptor couples to adenylate cyclase (AC) via Gαs proteins, increasing intracellular cAMP levels . This signaling cascade is critical for diverse physiological processes:

  • Vascular and gastrointestinal smooth muscle relaxation

  • Thermoregulation and circadian rhythm modulation

  • Immune regulation (e.g., dendritic cell migration, IgA+ B cell differentiation)

  • Cognitive functions (learning, memory, and hippocampal-dependent processes)

Pathway ComponentRole in Htr7 SignalingExperimental Evidence
Gαs → AC → cAMP ↑Primary second messenger
Gβγ subunitsActivation of TRPA1 ion channels (neuronal excitation)
Cdc42 GTPaseDendritic cell morphology and chemotaxis
PKA (cAMP-dependent)TGFβ1 production in macrophages (fibrosis)

Immunological and Pathological Roles

Recombinant Htr7 has been instrumental in elucidating serotonin’s immunomodulatory effects:

  • Dendritic cell homing: Htr7 activation by enteric neuron-derived serotonin enhances lamina propria dendritic cell retention via CCR7 upregulation, promoting IgA+ B cell differentiation .

  • Fibrotic responses: Htr7-PKA signaling in macrophages drives TGFβ1 production, contributing to collagen deposition in bleomycin-induced skin fibrosis models .

  • Cancer resistance: Overexpression of Htr7 in pancreatic ductal adenocarcinoma (PDAC) cells correlates with gemcitabine resistance via EZH2-TPH1-5-HT7 axis activation .

Agonists and Antagonists

Recombinant Htr7 has been used to characterize selective ligands, enabling precise modulation of receptor activity:

CompoundTypeEC50 (nM)SelectivitySource
5-CT (5-carboxamidotryptamine)Agonist45–1565-HT7 > 5-HT1A > 5-HT2A
AS-19Agonist19176-fold over 5-HT1AR
SB-269970Antagonist1.2–63High specificity for 5-HT7
LP44 (HTR7 agonist)AgonistN/AActivates TRPA1 in sensory neurons

Structure-Activity Relationships (SAR)

Key structural features influencing Htr7 ligand affinity include:

  • Halogen substituents (e.g., iodine, bromine) at the 5-position of indole derivatives, enhancing binding affinity .

  • Imidazole cores in low-basicity scaffolds (e.g., AGH-107), which improve metabolic stability and blood-brain barrier permeability .

Neurological and Cognitive Studies

Recombinant Htr7 has been pivotal in understanding serotonin’s role in:

  • Learning and memory: Htr7 knockout mice show deficits in spatial memory tasks (e.g., Barnes maze), suggesting receptor involvement in hippocampal allocentric processing .

  • Rett and Fragile X syndromes: Agonists like AS-19 improve neuronal excitability in preclinical models .

Immune and Inflammatory Disorders

  • Irritable bowel syndrome: Htr7 antagonists reduce visceral hypersensitivity in mouse models by modulating enteric nerve fiber activity .

  • Skin fibrosis: Htr7-deficient mice exhibit reduced macrophage infiltration and collagen deposition in dermal fibrosis models .

Oncology and Drug Resistance

  • Pancreatic cancer: Htr7 overexpression in gemcitabine-resistant PDAC cells is linked to EZH2-mediated epigenetic regulation, enabling targeted therapeutic strategies .

Challenges and Future Directions

  1. Isoform-Specific Signaling: Differences in receptor internalization (e.g., 5-HT7(d)) may require isoform-specific recombinant models for accurate pharmacological profiling .

  2. Species-Specific Variations: Mouse Htr7 exhibits distinct splice variants and tissue distributions compared to human 5-HT7, necessitating cross-species validation .

  3. Therapeutic Potential: Development of CNS-penetrant Htr7 agonists/antagonists for neurological or immune disorders remains a priority .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage condition, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Htr7; 5-hydroxytryptamine receptor 7; 5-HT-7; 5-HT7; 5-HT-X; Serotonin receptor 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPA PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQK EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE ALKLAERPERSEFVLQNCDHCGKKGHDT
Uniprot No.

Target Background

Function
This receptor serves as one of multiple receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, hormone, and mitogen. Its activity is mediated by G proteins that stimulate adenylate cyclase.
Gene References Into Functions
  1. Downregulation of the 5-HT7 receptor in the medial prefrontal cortex (mPFC) improves neonatal administration of phencyclidine-induced attentional deficits and impulsive-like overresponding and exacerbates compulsivity. These findings suggest that 5-HT7R is involved in the cognitive outcomes of schizophrenia-like symptoms, mirroring human observations. PMID: 29278697
  2. The present study demonstrated that acute heroin administration resulted in notable disruptions in attention, impulsivity, and motivation in mice. PMID: 29155092
  3. The underlying molecular mechanisms involve 5-HT7R-mediated activation of MMP-9, leading to CD44 cleavage followed by Cdc42 activation. PMID: 28564597
  4. The findings of this study provide evidence for the essential role of the 5HT7R in the acquisition of an allocentric strategy and the ability to learn both strategies concurrently. PMID: 27939340
  5. The data from this study suggest that the 5-HT7R-mediated structural reorganization during postnatal development plays a crucial role in the development and plasticity of forebrain areas such as the cortex and striatum. PMID: 28122114
  6. This study demonstrates that 5-HT7 is expressed in the liver in vivo and in vitro in CCl4-induced damage, and that 5-HT7 receptor agonist, but not the antagonist, exhibits a hepatoprotective effect against liver fibrosis. PMID: 28043031
  7. 5-HT7 is required for multiple actions of serotonin in the mammary glands. PMID: 25664318
  8. Activation of HTR7 promoted opening of the ion channel TRPA1, which in turn triggered itch behaviors. Acute itch triggered by serotonin or a selective serotonin reuptake inhibitor required both HTR7 and TRPA1, as did the development of atopic dermatitis. PMID: 26074006
  9. Blockade of 5-HT7R Results in Increased Severity of Chronic DSS-induced Colitis. PMID: 25072499
  10. Data suggest that 5-HT7R tonically modulates cognitive processes involved in consolidation performances in object recognition. PMID: 23995300
  11. These results indicate that 5-HT receptors are functionally expressed in a subpopulation of substantia gelatinosa neurons and that activation of 5-HT receptors plays a significant role in modulating orofacial nociceptive processing. PMID: 24516875
  12. The results provide evidence that lurasidone can act as a 5-HT7 receptor antagonist and offer a possible explanation for its antidepressant effect. PMID: 23416039
  13. Colitis severity was significantly lower in 5-HT7(-/-) mice. PMID: 23554310
  14. The 5-HT7 receptor is functionally involved in the development of stress adaptation.[review] PMID: 23012886
  15. Activation of the serotonin 5-HT7 receptor promotes synaptogenesis and enhances synaptic activity in hippocampal neurons at early postnatal stages. PMID: 22378867
  16. 5-HT-induced hypothermia is mediated by the 5-HT(7) receptor PMID: 12529502
  17. Binding sites consistent with mRNA distribution with highest densities found in anterior thalamic nuclei. PMID: 15026130
  18. The results indicate an important role for the 5-HT(7) receptor in contextual hippocampal-dependent learning and suggest a possible neuronal correlate for such a role is present within the CA1 region of the hippocampus. PMID: 15078565
  19. Data demonstrate distinct roles for 5-HT7R/G12 signaling pathways in neurite outgrowth and retraction PMID: 16120784
  20. The results, obtained with selective antagonists and knockout animals, provide compelling evidence of a specific contribution of 5-HT7 receptors to spinal locomotor rhythmogenesis in vivo. PMID: 16836640
  21. The 5-HT7 receptor is significant for behaviors affected by antidepressants, suggesting its potential relevance as a target for treating obsessive-compulsive disorder. PMID: 17267119
  22. Cloning, genomic organization, and functionality of 5-HT7 receptor splice variants from mouse brain are reported. PMID: 18793707
  23. 5-HT(7) receptor deletion augments the effect of various SSRIs on REM sleep suppression, and this effect is distinct from those mediated via 5-HT(1A) receptors. PMID: 18948124
  24. The present study has shown that the 5-HT7 receptor is important for allocentric spatial memory. PMID: 19447277
  25. These results suggest that spinal 5-HT7 receptors are necessary for the production and coordination of 5-HT-induced locomotor-like activity in neonatal mice and are crucial for coordinating voluntary locomotion in adult mice. PMID: 19458153

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.