Recombinant Mouse 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase (Cyp8b1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
Cyp8b1; Cyp12; 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase; 7-alpha-hydroxy-4-cholesten-3-one 12-alpha-hydroxylase; CYPVIIIB1; Cytochrome P450 8B1; Sterol 12-alpha-hydroxylase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-500
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
TLWCTVLGALLTVVGCLCLSLLLRHRRPWEPPLDKGFVPWLGHSMAFRKNMFEFLKGMRAKHGDVFTVQLGGQYFTFVMDPLSFGPIIKNTEKALDFQSYAKELVLKVFGYQSVDGDHRMIHLASTKHLMGQGLEELNQAMLDSLSLVMLGPKGSSLGASSWCEDGLFHFCYRILFKAGFLSLFGYTKDKQQDLDEADELFRKFRRFDFLFPRFVYSLLGPREWVEVSQLQRLFHQRLSVEQNLEKDGISCWLGYMLQFLREQGIASSMQDKFNFMMLWASQGNTGPTCFWVLLFLLKHQDAMKAVREEATRVMGKARLEAKKSFTFTPSALKHTPVLDSVMEESLRLCATPTLLRVVQEDYVLKMASGQEYQIRRGDKVALFPYLSVHMDPDIHPEPTAFKYDRFLNPDGTRKVDFYKSGKKIHHYSMPWGSGVSKCPGRFFALSEMKTFVLLMIMYFDFKLVDPDIPVPPIDPRRWGFGTSQPSHEVRFLYRLKPVQ
Uniprot No.

Target Background

Function

Cytochrome P450 monooxygenase CYP8B1 is a key enzyme in primary bile acid biosynthesis. It catalyzes the 12α-hydroxylation of 7α-hydroxy-4-cholesten-3-one, a crucial intermediate in cholic acid biosynthesis. CYP8B1 regulates the biliary balance of cholic acid and chenodeoxycholic acid, thereby influencing the intestinal absorption of dietary lipids. Mechanistically, it utilizes molecular oxygen, incorporating one oxygen atom into the substrate while reducing the second to water. This process requires two electrons supplied by NADPH via cytochrome P450 reductase (CPR).

Gene References Into Functions
  1. Cyp8b1(-/-) mice exhibited resistance to Western diet-induced weight gain, hepatic steatosis, and insulin resistance. PMID: 28377401
  2. Cyp8b1 deficiency improved glucose tolerance, insulin sensitivity, and β-cell function in mice, attributed to the absence of cholic acid. PMID: 25338812
  3. RORα is a crucial regulator of the diurnal rhythm and fasting-induced expression of CYP8B1, influencing bile acid composition and serum/liver cholesterol levels. PMID: 24226095
  4. In a C57BL/6J and CASA/Rk intercross study, Cyp8b1 was not identified as a determinant of biliary bile acid composition. PMID: 16763287
  5. The expression pattern of Cyp8b1 was investigated in hepatocytes. PMID: 17237956
  6. In vitro and in vivo murine studies explored the isoflavone-mediated induction of 12α-hydroxylase (CYP8B1). PMID: 17585019
Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in liver.

Q&A

What is the primary function of Cyp8b1 in bile acid biosynthesis?

Cyp8b1 (7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase) is a cytochrome P450 monooxygenase that plays a crucial role in primary bile acid biosynthesis . Its primary enzymatic function is catalyzing the 12α-hydroxylation of 7α-hydroxycholest-4-en-3-one, which is an intermediate metabolite in the synthesis pathway of cholic acid . This reaction represents a critical branching point in bile acid synthesis that determines the ratio of cholic acid to chenodeoxycholic acid in the bile acid pool. Through this activity, Cyp8b1 ultimately regulates the intestinal absorption of dietary lipids by controlling the biliary balance between these two primary bile acids . The enzyme employs a typical P450 catalytic mechanism, using molecular oxygen to insert one oxygen atom into the substrate while reducing the second oxygen atom to water, with electrons provided by NADPH via cytochrome P450 reductase (CPR) .

What expression systems are most effective for producing recombinant Cyp8b1?

Bacterial expression systems, particularly modified E. coli strains, have proven effective for recombinant Cyp8b1 production . Based on the experimental procedures outlined in the literature, successful expression typically involves truncation of the N-terminal membrane anchor sequence and addition of affinity tags to facilitate purification . The transformation of expression constructs into E. coli cells is followed by culture growth at lower temperatures (typically 28-30°C) after induction, which helps to improve protein folding and incorporation of the heme cofactor. Supplementation with δ-aminolevulinic acid, a heme precursor, can significantly enhance the yield of catalytically active enzyme . Expression success is typically monitored through SDS-PAGE analysis and spectroscopic characterization, particularly examining the characteristic Soret absorption band at approximately 417 nm, which indicates proper heme incorporation. For mouse Cyp8b1 specifically, codon optimization for bacterial expression may improve protein yields compared to the native sequence.

What are the recommended purification procedures for recombinant Cyp8b1?

Purification of recombinant Cyp8b1 typically employs a multi-step chromatographic approach to achieve high purity while maintaining catalytic activity . The initial capture step often utilizes nickel-nitrilotriacetic acid (NiNTA) affinity chromatography, leveraging histidine tags engineered into the recombinant construct . Following cell lysis and membrane solubilization with detergents, the clarified lysate is applied to the NiNTA column, with elution typically performed using an imidazole gradient or step elution with 8 mM histidine . Subsequent purification steps often include ion-exchange chromatography, particularly using carboxymethyl (CM) resins with gradient elution, which effectively separates Cyp8b1 from contaminants based on charge differences . A final polishing step using size-exclusion chromatography helps remove aggregates and ensures a homogeneous enzyme preparation . Throughout the purification process, fractions should be monitored for protein content (A280) and heme incorporation (A417), with pooled fractions assessed for purity by SDS-PAGE and functional integrity through spectroscopic analysis, particularly the characteristic reduced carbon monoxide difference spectrum showing a peak at 450 nm .

How is Cyp8b1 catalytic activity typically measured in laboratory settings?

Measurement of Cyp8b1 catalytic activity involves quantifying the conversion of 7α-hydroxycholest-4-en-3-one to 7α,12α-dihydroxycholest-4-en-3-one under controlled conditions . The standard enzymatic assay typically contains purified recombinant Cyp8b1, cytochrome P450 reductase as the electron transfer partner, substrate (7α-hydroxycholest-4-en-3-one), and NADPH as the electron source in an appropriate buffer system . Reactions are generally initiated by the addition of NADPH and terminated after a defined period by the addition of organic solvent or acid. Analysis of substrate conversion is most accurately performed using liquid chromatography (LC) methods coupled with mass spectrometry (MS) detection, which allows for sensitive and specific quantification of both substrate and product . For kinetic parameter determination, multiple substrate concentrations are tested, and the resulting reaction velocities are fitted to the Michaelis-Menten equation to derive Km and kcat values . Control reactions lacking NADPH are essential to confirm that product formation is dependent on catalytic activity rather than non-enzymatic processes. When evaluating inhibitors, IC50 values can be determined by measuring enzyme activity in the presence of various inhibitor concentrations .

How can site-directed mutagenesis be used to investigate structure-function relationships in Cyp8b1?

Site-directed mutagenesis represents a powerful approach for exploring structure-function relationships in Cyp8b1, as demonstrated by the characterization of the W281F mutant . This technique involves the targeted modification of specific amino acid residues identified through structural analysis or sequence alignment with related P450 enzymes. Primers containing the desired nucleotide changes are designed and used in polymerase chain reaction (PCR) to generate the mutated gene, which is then verified by sequencing before expression in the appropriate host system . Comparative characterization of wild-type and mutant enzymes should include comprehensive analysis of spectral properties, substrate binding affinities, and catalytic parameters. For example, the W281F mutation in Cyp8b1 resulted in significant functional changes, including altered substrate binding (Kd increased from 2.2 ± 0.4 μM to 17.4 ± 2.6 μM) and dramatically reduced catalytic efficiency (kcat/Km decreased approximately 23-fold) . These changes can be interpreted in the context of structural models, with tryptophan 281 likely playing a critical role in substrate recognition and positioning within the active site. Similar mutagenesis studies targeting residues in substrate recognition sites (SRS) or the heme-binding region can provide valuable insights into the molecular determinants of Cyp8b1 substrate specificity and catalytic mechanism.

What crystallization techniques have been successful for Cyp8b1 structural determination?

Successful crystallization of Cyp8b1 has been achieved using co-crystallization approaches with inhibitors, as exemplified by the structure determination with (S)-tioconazole . The crystallization process typically begins with the preparation of highly purified, homogeneous protein (>95% purity) concentrated to approximately 20-30 mg/mL in a suitable buffer system. Prior to crystallization trials, the enzyme is typically incubated with the ligand of interest to form a stable complex. The crystallization conditions that have proven successful include the vapor diffusion method, specifically hanging or sitting drop techniques, with reservoir solutions containing polyethylene glycols as precipitants and buffers in the pH range of 6.0-7.5 . Optimization of crystal growth often requires systematic variation of protein concentration, precipitant concentration, pH, and additives such as salts or small molecules that promote crystal packing. Crystals of sufficient quality for diffraction studies typically grow over several days to weeks at controlled temperatures (4-20°C). Once formed, crystals are harvested and cryoprotected before flash-cooling in liquid nitrogen for X-ray diffraction data collection, typically at synchrotron radiation sources to achieve high-resolution data . The structure solution process involves molecular replacement using related P450 structures as search models, followed by iterative rounds of model building and refinement to produce the final structural model .

What are the most effective inhibitors of Cyp8b1 and how can inhibition kinetics be accurately determined?

Several azole compounds have demonstrated effective inhibition of Cyp8b1, with tioconazole, econazole, miconazole, clotrimazole, and liarozole showing particularly strong inhibitory potential . Accurate determination of inhibition kinetics involves systematic methodology using recombinant enzyme preparations. Initially, spectral binding studies help characterize the interaction between inhibitor and enzyme, with Type II spectral shifts (characteristic peak at 430-435 nm and trough at 410-415 nm) typically observed for azole compounds that directly coordinate to the heme iron . For quantitative inhibition analysis, enzyme activity assays are conducted using the native substrate (7α-hydroxycholest-4-en-3-one) at concentrations near its Km value, with varying concentrations of the inhibitor compound . The resulting activity data are fitted to appropriate inhibition models (competitive, noncompetitive, or mixed) to determine inhibition constants (Ki values). Among the characterized azoles, tioconazole demonstrated the most potent inhibition with an IC50 value of 0.044 μM, followed by econazole (0.088 μM), miconazole (0.14 μM), and clotrimazole (0.20 μM) . The inhibition mechanism typically involves direct coordination of the azole nitrogen to the heme iron, as confirmed by spectral analysis and crystallographic studies . This methodology can be extended to evaluate novel inhibitor candidates, including non-azole compounds with potential for greater selectivity toward Cyp8b1.

How can molecular docking be used to predict Cyp8b1-substrate interactions?

Molecular docking represents a valuable computational approach for predicting interactions between Cyp8b1 and its substrates, as demonstrated by the docking of 7α-hydroxycholest-4-en-3-one into the enzyme active site . This technique requires a high-quality three-dimensional structure of the enzyme, typically derived from X-ray crystallography data, with the heme cofactor properly positioned . The substrate molecule is prepared with appropriate geometry optimization and charge assignment before docking. Various docking algorithms and software packages (such as AutoDock, GOLD, or Glide) can be employed, with parameters optimized for P450 enzymes, particularly accounting for the heme iron coordination chemistry. Multiple docking runs generate an ensemble of potential binding poses, which are then evaluated based on scoring functions that estimate binding energy and interaction quality . The most favorable binding modes are further analyzed for key protein-ligand interactions, with particular attention to the positioning of the substrate carbon atom targeted for hydroxylation relative to the heme iron (typically 4-5 Å for productive metabolism) . The docking results can be validated by comparing predictions with experimental data, such as site-directed mutagenesis effects on binding and catalysis. For example, docking studies with 7α-hydroxycholest-4-en-3-one revealed specific interactions with active site residues, including the important role of W281 in substrate recognition and positioning, which aligned with the experimental effects observed in the W281F mutant .

How does Cyp8b1 activity influence cholesterol metabolism and metabolic diseases?

Cyp8b1 plays a pivotal role in cholesterol metabolism by controlling the balance between cholic acid and chenodeoxycholic acid, which significantly impacts cholesterol homeostasis and related metabolic processes . Through its 12α-hydroxylation activity, Cyp8b1 determines the hydrophobicity of the bile acid pool, with higher cholic acid production (dependent on Cyp8b1) resulting in more efficient intestinal cholesterol absorption . Consequently, alterations in Cyp8b1 expression or activity have been implicated in several metabolic diseases. Downregulation of Cyp8b1 has been observed in non-alcoholic fatty liver disease, suggesting a potential compensatory mechanism to reduce cholesterol absorption during hepatic steatosis . In type 2 diabetes, modulation of Cyp8b1 activity can influence glucose metabolism through effects on bile acid composition and subsequent activation of farnesoid X receptor (FXR) and TGR5 signaling pathways, which regulate hepatic gluconeogenesis and insulin sensitivity. Research approaches investigating these relationships typically include gene knockout or knockdown models, metabolomic analysis of bile acid profiles, and correlation of Cyp8b1 expression levels with disease markers in clinical samples. Understanding these connections provides potential therapeutic opportunities through targeted inhibition of Cyp8b1 to modify bile acid composition and ameliorate metabolic dysfunctions.

What techniques are used to study Cyp8b1 in knockout or transgenic mouse models?

Investigation of Cyp8b1 function in knockout or transgenic mouse models employs a range of specialized techniques to characterize the physiological impact of altered enzyme activity . Generation of Cyp8b1 knockout mice typically utilizes CRISPR/Cas9 technology or traditional homologous recombination methods targeting the Cyp8b1 gene. Verification of the knockout involves genomic PCR, RNA expression analysis (RT-qPCR), and protein detection (Western blotting) using specific antibodies . Phenotypic characterization includes comprehensive metabolic profiling, focusing on bile acid composition analyzed by liquid chromatography-mass spectrometry (LC-MS/MS) to quantify cholic acid, chenodeoxycholic acid, and their derivatives in various biological fluids and tissues . Metabolic flux studies using stable isotope-labeled cholesterol can track the dynamic changes in bile acid synthesis pathways. Physiological assessment includes measurements of intestinal cholesterol absorption efficiency (typically using dual-isotope methods), serum lipid profiles, glucose tolerance tests, and insulin sensitivity assays to determine the impact on metabolic health . Tissue-specific effects are evaluated through histological analysis of liver morphology, measurement of hepatic fat content, and assessment of gut microbiome composition, which can be significantly affected by altered bile acid profiles. These mouse models provide valuable platforms for testing potential Cyp8b1 inhibitors and their effects on cholesterol homeostasis under physiological conditions.

How can recombinant Cyp8b1 be used to screen potential therapeutic compounds?

Recombinant Cyp8b1 provides an efficient platform for screening potential therapeutic compounds targeting bile acid metabolism . Development of a high-throughput screening assay typically begins with optimization of the enzymatic reaction conditions using purified recombinant Cyp8b1 and cytochrome P450 reductase in a reconstituted system . The assay can be miniaturized to 96- or 384-well plate format, with activity detection methods including fluorescence-based approaches (if suitable fluorogenic substrates can be identified) or LC-MS/MS for direct quantification of 7α,12α-dihydroxycholest-4-en-3-one formation . Compound libraries are screened at single concentrations initially (typically 10 μM), with hits defined as compounds showing >50% inhibition. These primary hits undergo secondary confirmation assays at multiple concentrations to determine IC50 values, followed by selectivity assessment against related P450 enzymes involved in bile acid synthesis (CYP7A1, CYP27A1) and drug metabolism (CYP3A4, CYP2D6) . Structure-activity relationship studies can be informed by docking analyses using the crystal structure of Cyp8b1 . Lead compounds may include novel azole derivatives with improved selectivity profiles or non-azole structures designed based on the substrate scaffold, such as steroid cores with aziridine modifications or pyridine replacements . Promising inhibitors should be further evaluated in cellular systems (hepatocytes) to confirm target engagement and pathway modulation before advancing to in vivo testing in appropriate animal models.

What are the challenges in translating Cyp8b1 research from mouse models to human applications?

Translating Cyp8b1 research from mouse models to human applications presents several significant challenges that researchers must address through careful comparative studies . Species differences in Cyp8b1 sequence, expression patterns, and regulation can impact the extrapolation of findings. Human CYP8B1 shares approximately 70% amino acid identity with mouse Cyp8b1, which necessitates comparative biochemical characterization of both enzymes to identify potential differences in substrate specificity, inhibitor sensitivity, and catalytic efficiency . Regulatory elements controlling gene expression may also differ, potentially resulting in distinct responses to physiological stimuli or drug treatments. The bile acid pool composition varies between mice and humans, with mice having a higher proportion of muricholic acids that are not found in humans, potentially altering the metabolic consequences of Cyp8b1 inhibition . To address these challenges, researchers typically employ parallel studies with recombinant human and mouse enzymes, humanized mouse models (where mouse Cyp8b1 is replaced with human CYP8B1), and validation of findings in human hepatocytes or liver slices . Pharmacokinetic and pharmacodynamic properties of potential inhibitors must be evaluated in both species, with particular attention to metabolic stability, tissue distribution, and target engagement. Biomarkers of Cyp8b1 inhibition, such as changes in specific bile acid ratios, should be validated in both preclinical models and human samples to establish translatable endpoints for clinical studies.

What statistical approaches are most appropriate for analyzing Cyp8b1 enzyme kinetics data?

Analysis of Cyp8b1 enzyme kinetics requires rigorous statistical approaches to ensure accurate determination of kinetic parameters and reliable comparison between experimental conditions . For basic Michaelis-Menten kinetics, non-linear regression analysis should be applied directly to the velocity versus substrate concentration data rather than linearization methods (e.g., Lineweaver-Burk plots), as the latter can distort error distribution . Statistical software packages such as GraphPad Prism or R with appropriate enzyme kinetics packages can fit the data to the Michaelis-Menten equation:

v=Vmax×[S]Km+[S]v = \frac{V_{max} \times [S]}{K_m + [S]}

where v is the reaction velocity, Vmax is the maximum velocity, [S] is the substrate concentration, and Km is the Michaelis constant . The goodness of fit should be evaluated using the coefficient of determination (R²) and residual analysis . For each kinetic parameter (Km, Vmax, kcat), 95% confidence intervals should be calculated to indicate the precision of the estimates . When comparing wild-type and mutant enzymes (such as the W281F variant), statistical significance of differences in kinetic parameters can be assessed using t-tests if the data meet normality assumptions, or non-parametric alternatives if not . For inhibition studies, IC50 values should be determined by fitting dose-response curves to a four-parameter logistic equation, with appropriate transformation to Ki values using the Cheng-Prusoff equation if the inhibition mechanism is competitive . All experiments should be performed in at least triplicate to ensure reproducibility, with error propagation applied when calculating derived parameters such as kcat/Km .

How can researchers troubleshoot low activity or instability issues with recombinant Cyp8b1?

Researchers encountering low activity or instability with recombinant Cyp8b1 can implement a systematic troubleshooting approach addressing multiple aspects of protein expression and handling . Expression issues may stem from poor protein folding or inadequate heme incorporation, which can be addressed by optimizing induction conditions (temperature, inducer concentration), supplementing growth media with δ-aminolevulinic acid as a heme precursor, and co-expressing molecular chaperones such as GroEL/GroES to assist with folding . Verification of correct heme incorporation should be performed spectroscopically, with a well-defined Soret band at approximately 417 nm and a characteristic reduced carbon monoxide difference spectrum showing a peak at 450 nm rather than 420 nm (which would indicate inactive P420 species) . For purified enzyme preparations showing low activity, buffer optimization is crucial, with particular attention to pH (typically 7.4-7.5 is optimal), ionic strength, and the presence of stabilizing agents such as glycerol (10-20%) or appropriate detergents for this membrane-associated enzyme . Stability can be enhanced by adding reducing agents (e.g., dithiothreitol or β-mercaptoethanol) to prevent oxidation of critical cysteine residues, and protease inhibitors to prevent degradation . The electron transfer system should be carefully evaluated, ensuring that cytochrome P450 reductase is active and present in sufficient molar ratio (typically 1:2 to 1:4 P450:reductase) . If activity remains suboptimal, alternative substrate preparation methods (different solubilization approaches) or detection systems (more sensitive analytical methods) may be necessary to accurately measure the enzymatic activity .

How do researchers integrate structural biology and enzymatic data to understand Cyp8b1 catalytic mechanism?

Integration of structural biology and enzymatic data provides a comprehensive understanding of the Cyp8b1 catalytic mechanism through a multidisciplinary approach . Crystallographic structures, such as the CYP8B1 structure co-crystallized with (S)-tioconazole, serve as the foundation for mechanistic hypotheses by revealing active site architecture, substrate binding pockets, and key residues involved in catalysis . These structures can be complemented by computational methods including molecular dynamics simulations to capture protein flexibility and water molecule movements that may be critical for substrate access channels and product egress. The validation and refinement of structural insights come from systematic enzymatic studies, including site-directed mutagenesis of catalytically important residues (such as the W281F mutation) followed by detailed kinetic characterization . The functional consequences of these mutations (changes in Km, kcat, binding affinity) provide experimental evidence for the role of specific residues in substrate recognition and positioning . Spectroscopic techniques, including UV-visible spectroscopy to monitor substrate binding (Type I shifts) and inhibitor interactions (Type II shifts), offer additional mechanistic information about the electronic state of the heme iron during the catalytic cycle . Advanced spectroscopic methods such as resonance Raman, electron paramagnetic resonance, and stopped-flow kinetics can further characterize reaction intermediates. Researchers then synthesize these diverse data types into a coherent catalytic model, using structural information to explain kinetic observations and guide further experiments, creating an iterative process of hypothesis generation and testing to refine understanding of the Cyp8b1 mechanism .

How does Cyp8b1 differ from other P450 enzymes involved in bile acid synthesis?

Cyp8b1 exhibits distinct characteristics compared to other P450 enzymes involved in bile acid synthesis (CYP7A1, CYP7B1, CYP27A1, and CYP39A1) in terms of substrate specificity, reaction chemistry, and physiological regulation . Unlike CYP7A1, which catalyzes the initial and rate-limiting 7α-hydroxylation of cholesterol, Cyp8b1 operates downstream in the pathway, specifically recognizing 7α-hydroxycholest-4-en-3-one as its primary substrate for 12α-hydroxylation . This substrate specificity is stricter than that of CYP27A1, which can hydroxylate multiple sterol substrates at different positions . Structurally, Cyp8b1 possesses a unique active site architecture adapted for precise positioning of the sterol substrate to enable regioselective hydroxylation at the 12α position, with critical residues such as W281 playing important roles in substrate recognition and binding that are not conserved across other bile acid-synthesizing P450s . From a regulatory perspective, Cyp8b1 expression is primarily controlled by bile acid feedback mechanisms through the farnesoid X receptor (FXR) and small heterodimer partner (SHP), but with distinct response elements and sensitivity compared to CYP7A1 . Functionally, Cyp8b1 represents a critical branch point in bile acid synthesis that determines the ratio of cholic acid to chenodeoxycholic acid, unlike other enzymes in the pathway that do not directly influence this important ratio . These distinctive features make Cyp8b1 a particularly attractive target for selective therapeutic intervention in conditions where modulating bile acid composition without completely disrupting bile acid synthesis is desirable.

What methodologies are most effective for studying interactions between Cyp8b1 and cytochrome P450 reductase?

Investigating interactions between Cyp8b1 and cytochrome P450 reductase (CPR) requires specialized methodologies that capture both physical associations and functional coupling . Protein-protein interaction studies can employ surface plasmon resonance (SPR) to determine binding kinetics and affinity constants between purified Cyp8b1 and CPR under various conditions. Isothermal titration calorimetry (ITC) provides complementary thermodynamic parameters of the interaction, including enthalpy and entropy changes. Crosslinking experiments using bifunctional reagents followed by mass spectrometry analysis can identify specific contact regions between the two proteins. For functional studies, electron transfer efficiency can be measured using artificial electron acceptors such as cytochrome c, with rates compared in the presence and absence of substrate to assess substrate-induced conformational changes that may enhance CPR coupling . Reconstitution experiments systematically varying the ratio of Cyp8b1 to CPR (typically testing ratios from 1:0.5 to 1:10) help determine the optimal stoichiometry for maximum activity . The effect of membrane composition on the interaction can be evaluated by reconstituting the proteins in liposomes of defined phospholipid composition. Advanced fluorescence techniques, including Förster resonance energy transfer (FRET) between labeled Cyp8b1 and CPR, can monitor real-time association dynamics in response to substrate binding or changes in redox state. Computational approaches such as protein-protein docking and molecular dynamics simulations complement experimental data by predicting interaction interfaces and conformational changes involved in complex formation and electron transfer between the redox partners.

How can researchers differentiate between Cyp8b1 and other P450 enzymes in complex biological samples?

Differentiating Cyp8b1 from other P450 enzymes in complex biological samples requires selective analytical approaches targeting unique characteristics of this enzyme . Immunological methods using highly specific antibodies against Cyp8b1, such as those developed for Western blotting applications, can selectively detect the protein in tissue homogenates or subcellular fractions . These antibodies should be validated for cross-reactivity against related P450 enzymes to ensure specificity. At the functional level, activity-based assays can exploit the unique substrate specificity of Cyp8b1 for 7α-hydroxycholest-4-en-3-one by measuring the formation of 7α,12α-dihydroxycholest-4-en-3-one using liquid chromatography-tandem mass spectrometry (LC-MS/MS) with multiple reaction monitoring (MRM) for high sensitivity and selectivity . The use of selective Cyp8b1 inhibitors, such as tioconazole or other characterized azole compounds, as competitive agents in the assay can confirm the contribution of Cyp8b1 to the observed activity . At the genetic level, quantitative PCR using primers targeting unique regions of the Cyp8b1 mRNA sequence provides specific measurement of expression levels. For in situ detection in tissue sections, RNA in situ hybridization or immunohistochemistry with validated antibodies can localize Cyp8b1 expression with cellular resolution. In complex proteomic analyses, targeted mass spectrometry approaches such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) focusing on unique peptide sequences from Cyp8b1 enable specific quantification among thousands of proteins in biological samples.

What are the evolutionary implications of Cyp8b1 conservation across species?

The evolutionary conservation of Cyp8b1 across species provides valuable insights into the fundamental importance of bile acid metabolism in vertebrate physiology . Comparative genomic analyses reveal that Cyp8b1 orthologs are present in most vertebrates, suggesting that the 12α-hydroxylation function emerged early in vertebrate evolution and has been maintained under selective pressure. Sequence alignment across species shows conservation of critical catalytic residues in the active site and heme-binding region, while greater variability exists in substrate recognition sites, potentially reflecting adaptation to species-specific sterol metabolism patterns . Functional studies comparing recombinant Cyp8b1 from different species (human, mouse, rat) demonstrate conservation of the core catalytic function, though with potential differences in substrate affinity, reaction rates, and inhibitor sensitivity that may influence translational aspects of research . The co-evolution of Cyp8b1 with nuclear receptors that regulate bile acid homeostasis (such as FXR) suggests coordinated adaptation of the entire bile acid signaling network. From a physiological perspective, species differences in the bile acid pool composition correlate with Cyp8b1 expression and activity levels, with some species producing predominantly cholic acid while others maintain higher proportions of chenodeoxycholic acid or species-specific bile acids. These evolutionary patterns inform experimental design by highlighting the importance of species selection in model systems, potential limitations in extrapolating findings across species, and opportunities to leverage natural variation to understand structure-function relationships and design species-selective inhibitors for research or therapeutic applications.

What analytical techniques provide the most accurate quantification of Cyp8b1 metabolites?

Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) represents the gold standard for accurate quantification of Cyp8b1 metabolites, particularly 7α,12α-dihydroxycholest-4-en-3-one, due to its unparalleled sensitivity, specificity, and dynamic range . Method development typically begins with optimization of chromatographic separation using reverse-phase columns (C18 or C8) with carefully designed mobile phase gradients to achieve baseline separation of the metabolite from structurally related sterols . Mass spectrometric detection employs multiple reaction monitoring (MRM) or parallel reaction monitoring (PRM) modes, focusing on specific precursor-to-product ion transitions (such as m/z 417→399 for 7α,12α-dihydroxycholest-4-en-3-one after loss of water) that provide high selectivity . Quantification accuracy depends critically on proper sample preparation, which typically involves liquid-liquid extraction or solid-phase extraction to remove interfering compounds from biological matrices, followed by careful evaporation and reconstitution steps to concentrate the analytes. Stable isotope-labeled internal standards (deuterated or 13C-labeled versions of the metabolites) should be used to correct for matrix effects and variations in extraction efficiency . Method validation should include assessment of linearity, lower limits of quantification (typically in the low nanomolar range), accuracy, precision, and stability under various storage conditions. Alternative approaches include gas chromatography-mass spectrometry (GC-MS) after derivatization (typically trimethylsilylation) to enhance volatility of the sterol metabolites, though this requires additional sample preparation steps. For high-throughput screening applications, enzyme-linked immunosorbent assays (ELISA) using metabolite-specific antibodies may be developed, though these generally offer lower specificity compared to MS-based methods .

What are the best practices for handling and storing recombinant Cyp8b1 to maintain activity?

Maintaining the activity of recombinant Cyp8b1 requires careful attention to handling and storage conditions that preserve protein stability and heme integrity . Immediately following purification, the enzyme should be concentrated to approximately 1-2 mg/mL in an optimized buffer system, typically containing 50 mM phosphate or Tris buffer (pH 7.4-7.5), 20% glycerol as a cryoprotectant, 0.1 mM EDTA to chelate heavy metals that could promote oxidative damage, and 0.1 mM dithiothreitol (DTT) or another reducing agent to maintain cysteine residues in the reduced state . For short-term storage (1-2 weeks), the protein can be kept at 4°C with minimal loss of activity when protected from light to prevent photodegradation of the heme. For long-term storage, flash freezing in liquid nitrogen followed by storage at -80°C is recommended, with aliquoting into single-use volumes to avoid repeated freeze-thaw cycles that significantly reduce activity . When thawing, samples should be rapidly warmed in a room temperature water bath and immediately placed on ice. Stability can be monitored spectroscopically by regular measurement of the Soret peak intensity and position, with shifts from 417 nm or peak broadening indicating heme degradation or protein denaturation . Functional stability should be assessed through periodic activity assays using standard conditions. If activity loss is observed during storage, addition of fresh reducing agent or buffer exchange may help recover some activity. For applications requiring extended stability at room temperature or 37°C (such as high-throughput screening assays), addition of stabilizing agents such as bovine serum albumin (0.1-0.5 mg/mL) or specific substrate analogs that promote a more stable conformation without undergoing metabolism can significantly extend the functional lifetime of the enzyme preparation .

How can gene editing technologies be applied to study Cyp8b1 function in cellular and animal models?

CRISPR/Cas9 and related gene editing technologies offer powerful approaches for investigating Cyp8b1 function with unprecedented precision in both cellular and animal models . For cellular studies, CRISPR/Cas9-mediated knockout of Cyp8b1 in hepatocyte cell lines (such as mouse AML12 or human HepG2 cells) enables evaluation of enzyme function in a controlled environment. Guide RNAs targeting critical exons of Cyp8b1 can be designed using computational tools that minimize off-target effects, with delivery via plasmid transfection or lentiviral vectors depending on cell type . Verification of knockout efficiency should combine genomic sequencing to confirm mutations, RT-qPCR to assess mRNA levels, and Western blotting to confirm protein elimination . More sophisticated editing approaches include knock-in of specific mutations (such as the W281F variant) to study structure-function relationships, or insertion of reporter tags (such as fluorescent proteins or epitope tags) for real-time monitoring of expression and localization . For animal models, CRISPR/Cas9 delivery to mouse zygotes can generate germline Cyp8b1 modifications, while adeno-associated virus (AAV) vectors expressing Cas9 and guide RNAs enable liver-specific Cyp8b1 editing in adult animals, avoiding developmental compensation that may occur in germline models . Inducible editing systems (such as doxycycline-regulated Cas9 expression) allow temporal control over Cyp8b1 disruption to distinguish between acute and chronic effects of enzyme loss. Phenotypic analysis should include comprehensive bile acid profiling by LC-MS/MS, serum cholesterol measurements, glucose homeostasis assessment, and liver histology to evaluate the metabolic consequences of Cyp8b1 modification .

What opportunities do computational approaches offer for Cyp8b1 inhibitor design and optimization?

Computational approaches provide powerful tools for Cyp8b1 inhibitor design and optimization, leveraging structural insights to accelerate the development of selective and potent compounds . Structure-based drug design utilizing the crystallographic structure of Cyp8b1 can employ virtual screening of large compound libraries to identify hit scaffolds that fit the active site geometry and make favorable interactions with key residues . Molecular docking studies, as demonstrated with 7α-hydroxycholest-4-en-3-one, can predict binding modes and identify critical protein-ligand interactions that guide chemical optimization . Pharmacophore modeling based on known inhibitors (such as the characterized azole compounds) can define the essential chemical features required for Cyp8b1 inhibition, including the heme-coordinating nitrogen, hydrophobic regions, and hydrogen bond acceptors/donors . Quantum mechanical calculations can model the electronic structure of the heme-inhibitor complex to optimize metal coordination properties. For lead optimization, free energy perturbation methods can predict the impact of specific chemical modifications on binding affinity with greater accuracy than standard docking scores. Machine learning approaches trained on existing inhibitor data can generate quantitative structure-activity relationship (QSAR) models to prioritize synthesis candidates. Molecular dynamics simulations of protein-inhibitor complexes provide insights into binding stability and induced-fit effects that may not be apparent from static crystal structures . These computational approaches can specifically target the development of next-generation inhibitors with improved properties over existing azoles, such as steroid core structures with aziridine attachments or pyridine ring replacements that may offer greater selectivity for Cyp8b1 over other P450 enzymes .

How might single-molecule techniques advance understanding of Cyp8b1 conformational dynamics?

Single-molecule techniques offer unprecedented opportunities to explore the conformational dynamics of Cyp8b1 that are critical to its catalytic function but remain obscured in ensemble measurements . Single-molecule Förster resonance energy transfer (smFRET) can track distance changes between strategic locations within the enzyme by introducing fluorescent donor-acceptor pairs at specific sites using cysteine mutagenesis and subsequent labeling with thiol-reactive fluorophores. This approach can monitor conformational changes in real-time as Cyp8b1 progresses through the catalytic cycle, binding substrate, interacting with redox partners, and releasing product . Strategic placement of labels near substrate recognition sites (such as adjacent to W281) and the predicted cytochrome P450 reductase binding interface would be particularly informative. Single-molecule fluorescence correlation spectroscopy (FCS) can measure diffusion properties that reflect global conformational states and protein-protein interactions with cytochrome P450 reductase. Optical tweezers or atomic force microscopy-based approaches can probe the mechanical properties and stability of different Cyp8b1 conformational states upon substrate or inhibitor binding . High-speed atomic force microscopy (HS-AFM) offers the potential to directly visualize conformational changes at near-atomic resolution under physiologically relevant conditions. For membrane-associated studies, supported lipid bilayers with reconstituted Cyp8b1 enable investigation of how the membrane environment influences conformational dynamics. These techniques can specifically address key mechanistic questions about Cyp8b1, such as whether substrate binding induces conformational changes that facilitate reductase binding, how inhibitors like tioconazole alter the conformational landscape, and whether the W281F mutation impacts the enzyme's dynamic properties beyond static structural changes .

What are the prospects for developing selective Cyp8b1 modulators as therapeutic agents?

The development of selective Cyp8b1 modulators as therapeutic agents represents a promising frontier in metabolic disease treatment based on fundamental understanding of bile acid metabolism . Current research suggests that inhibiting Cyp8b1 could therapeutically alter the bile acid pool composition, reducing cholic acid while increasing chenodeoxycholic acid, thereby decreasing intestinal cholesterol absorption efficiency and potentially improving metabolic parameters in conditions such as non-alcoholic fatty liver disease and type 2 diabetes . Structure-based design approaches leveraging the crystallographic data on Cyp8b1 have identified potential scaffolds for selective inhibitors, including modified steroid cores with aziridine attachments to the C ring or pyridine replacements that maintain key interaction points while enhancing selectivity over other P450 enzymes . These compounds would ideally demonstrate >100-fold selectivity for Cyp8b1 over related bile acid-synthesizing enzymes (CYP7A1, CYP27A1) and drug-metabolizing P450s (CYP3A4, CYP2D6) to minimize off-target effects . Preclinical development would require optimization of pharmacokinetic properties, particularly hepatic targeting since Cyp8b1 is predominantly expressed in the liver, potentially through prodrug approaches or liver-specific delivery systems . Biomarkers for clinical development include serum bile acid profiling by LC-MS/MS, focusing on the cholic acid to chenodeoxycholic acid ratio as a direct measure of target engagement . Beyond inhibitors, partial agonists or allosteric modulators of Cyp8b1 could offer more nuanced regulation of bile acid composition compared to complete inhibition. The therapeutic potential extends beyond metabolic diseases to potential applications in cholestatic liver diseases where altering bile acid hydrophobicity could reduce hepatic toxicity, and even cancer therapy, given emerging roles of bile acid signaling in certain cancer types .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.