Recombinant Mouse Acyl-CoA wax alcohol acyltransferase 1 (Awat1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Awat1; Dgat2l3; Acyl-CoA wax alcohol acyltransferase 1; Diacylglycerol O-acyltransferase 2-like protein 3; Long-chain-alcohol O-fatty-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Awat1
Target Protein Sequence
MSCSMKTEHLQSLSLLQWPLSYVAMFWIVQPLLICLLFTPLWPLPTVYFVWLLLDWKTPD KGGRRSDWVRNWNVWNHIRDYFPITILKTKDLSPSENYIMGVHPHGLLTFGAFCNFCTEA TGFSKTFPGITPHLATLSWFFKIPIIRDYIMAKGLCSVSQASIDYLLSHGTGNLVGIVVG GVGEALQSVPNTTTLLLKKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHEDSRMFKF QSLFRRIFGFYCCVFYGQGFHQDCKGLLPYHKPIITVVGEALPLPQVKNPSPEIVDKYHA LYMDALYKLFEQHKVQYGCSNTQKLIFL
Uniprot No.

Target Background

Function
Recombinant Mouse Acyl-CoA wax alcohol acyltransferase 1 (Awat1) is an acyltransferase that catalyzes the formation of ester bonds between fatty alcohols and fatty acyl-CoAs, producing wax monoesters. It exhibits a strong preference for decyl alcohol (C10), with reduced activity towards C16 and C18 alcohols. A preference for saturated acyl-CoAs is also observed.
Gene References Into Functions
  1. Optimal activity was observed with 14:0-CoA, 12:0-CoA, and 16:0-CoA in conjunction with medium-chain alcohols (up to 5.2, 3.4, and 3.3 nmol wax esters/min/mg microsomal protein, respectively). PMID: 23730681
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Awat1 in mouse models?

Awat1 (acyl-CoA wax alcohol acyltransferase 1) primarily functions as an enzyme that esterifies long-chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. In mouse studies, Awat1 demonstrates characteristic substrate specificity and works together with Awat2 to produce diverse meibum lipids. Specifically, Awat1 is responsible for the synthesis of (O-acyl)-ω-hydroxy fatty acids and type 1ω wax diesters in meibum, which are critical components of the tear film lipid layer . This enzyme belongs to the diacylglycerol acyltransferase family and plays a central role in lipid metabolism, particularly in sebaceous glands and meibomian glands .

Where is Awat1 predominantly expressed in mouse tissues?

Awat1 is predominantly expressed in the sebaceous glands of the skin and in meibomian glands. This expression pattern correlates with its function in producing wax esters, which are enriched in sebum and meibum. The strategic localization of Awat1 in these specialized glands underscores its importance in maintaining the lipid composition necessary for proper skin barrier function and ocular surface protection . Expression studies in knockout models have revealed that Awat1 mRNA expression can be upregulated in Awat2 KO mice, suggesting compensatory regulatory mechanisms between these related genes .

What is the genomic organization of the mouse Awat1 gene?

The mouse Awat1 gene is located on the X chromosome, in close proximity to the Awat2 gene. This chromosomal positioning is significant for genetic manipulation strategies, as creating double knockout models through conventional breeding can be challenging due to their proximity . In humans, the orthologous AWAT1 gene is located at position Xq13.1 and comprises 7 exons . The close genomic organization of Awat1 and Awat2 genes suggests evolutionary conservation of these functionally related enzymes and may explain some of their overlapping and complementary functions in lipid metabolism.

What are the effective strategies for generating Awat1 knockout mouse models?

When generating Awat1 knockout mouse models, CRISPR/Cas9 technology has proven highly effective, particularly when creating single and double knockout models with Awat2. The proximity of Awat1 and Awat2 genes on the X chromosome makes traditional breeding approaches for creating double knockouts challenging. A more efficient approach involves co-injecting guide RNAs targeting both Awat1 and Awat2 into fertilized mouse eggs simultaneously .

For successful knockout generation, consider the following methodological workflow:

  • Design specific guide RNAs targeting exonic regions of Awat1

  • Co-inject the guide RNAs with Cas9 protein into fertilized mouse eggs

  • Implant manipulated eggs into pseudopregnant females

  • Screen resulting offspring for mutations using PCR and sequencing

  • Verify knockouts at both DNA and RNA levels to confirm gene disruption

  • Monitor for potential compensatory expression changes in related genes

This approach yields both single knockout mice with mutations in one gene (either Awat1 KO or Awat2 KO) and double knockout mice with mutations in both genes, providing valuable models for comparative functional studies .

What phenotypic assays are most informative for evaluating Awat1 function in vivo?

The most informative phenotypic assays for evaluating Awat1 function focus on ocular surface parameters and lipid composition analyses. Based on knockout studies, the following experimental approaches yield meaningful data:

  • Blinking frequency measurement: Record spontaneous blinking frequency under controlled environmental conditions. Awat1 KO mice show increased blinking (3.8 blinks/min) compared to wild-type controls (2.6 blinks/min) .

  • Tear film stability assessment: Measure tear breakup time (BUT) by applying fluorescein to the ocular surface and recording the time until dry spots appear. Awat1 KO mice exhibit significantly reduced BUT values compared to wild-type controls .

  • Tear fluid volume quantification: Measure using phenol red thread or similar standardized techniques. While Awat1 KO mice show minimal changes, this parameter is important for distinguishing from Awat2 KO phenotypes .

  • Meibum lipid analysis: Perform comprehensive lipidomic analysis using high-performance liquid chromatography and mass spectrometry to quantify specific lipid species, particularly focusing on:

    • (O-acyl)-ω-hydroxy fatty acids

    • Type 1ω wax diesters

    • Wax monoesters

    • Type 2ω wax diesters

These assays collectively provide a comprehensive evaluation of Awat1 function in vivo, with particular emphasis on its role in maintaining ocular surface homeostasis.

How can recombinant Awat1 be effectively expressed and purified for in vitro studies?

For effective expression and purification of recombinant mouse Awat1, consider the following optimized methodology:

  • Expression system selection: Mammalian expression systems (HEK293 or CHO cells) generally yield better functional enzyme than bacterial systems, as they provide appropriate post-translational modifications and membrane insertion.

  • Vector design: Incorporate a C-terminal tag (His6 or FLAG) rather than N-terminal tags to minimize interference with enzyme activity. Include a TEV protease cleavage site if tag removal is desired.

  • Solubilization strategy: As a membrane-associated enzyme, use mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS for effective solubilization while preserving activity.

  • Purification protocol:

    • Affinity chromatography using tag-specific resin

    • Size exclusion chromatography to enhance purity

    • Maintain detergent above critical micelle concentration throughout

  • Activity preservation: Include glycerol (10-20%) and reducing agents in storage buffers, and store in small aliquots at -80°C to maintain enzyme stability.

When designing experiments with purified recombinant Awat1, incorporate appropriate controls to verify enzyme activity, including substrate preference profiling using various chain-length alcohols and acyl-CoAs .

How does substrate specificity differ between Awat1 and Awat2, and what methods best characterize these differences?

Awat1 and Awat2 exhibit distinct substrate specificities that can be characterized through systematic biochemical approaches. The most effective methodological framework involves:

  • In vitro enzyme assays: Using purified recombinant enzymes with varied substrates:

    • Fatty alcohols of different chain lengths (C16-C30)

    • Acyl-CoAs with varying saturation and chain lengths

    • Specialized substrates like branched-chain fatty alcohols or hydroxy fatty acids

  • Product analysis: LC-MS/MS to identify and quantify specific wax ester species produced

Based on knockout mouse studies, the distinctive substrate specificities are evidenced by the lipid profiles of respective knockout models:

EnzymePrimary SubstratesMain ProductsProducts Reduced in KO Mice
Awat1Long-chain fatty alcohols with specific hydroxy fatty acids(O-acyl)-ω-hydroxy fatty acids, Type 1ω wax diesters(O-acyl)-ω-hydroxy fatty acids, Type 1ω wax diesters
Awat2Broader range of fatty alcohols and acyl-CoAsWax monoesters, Types 1ω and 2ω wax diestersWax monoesters, Types 1ω and 2ω wax diesters

This differential substrate utilization explains why Awat1 KO mice show milder phenotypes compared to Awat2 KO or double knockout mice, as Awat2 appears to have broader substrate specificity and contributes to a wider range of meibum lipid products .

What interactions exist between Awat1 and other enzymes in the lipid biosynthetic pathway?

Awat1 functions within a complex network of lipid biosynthetic enzymes. Research approaches to characterize these interactions should include:

  • Gene expression analysis: In knockout models, Awat1 disruption affects expression of related genes. For example, Awat1 mRNA expression is upregulated 1.8-fold in Awat2 KO mice, suggesting compensatory regulatory mechanisms .

  • Metabolic pathway analysis: The function of Awat1 is intimately connected with:

    • Fatty acyl-CoA reductases (FAR1 and FAR2) that produce the fatty alcohol substrates for Awat1

    • Fatty acid elongases and desaturases that generate the appropriate acyl-CoA substrates

    • Fatty acid hydroxylases that produce hydroxy fatty acids for specialized wax diester synthesis

  • Protein-protein interaction studies: Co-immunoprecipitation and proximity labeling approaches can identify physical interactions between Awat1 and other enzymes.

Research shows that Far1 expression is slightly affected by Awat2 knockout, indicating regulatory crosstalk between these pathways . A comprehensive understanding of these interactions requires integrated lipidomic and transcriptomic analyses, particularly focusing on how disruption of one pathway component affects the expression and function of others.

What are the implications of Awat1 mutations for ocular surface disease models?

Awat1 mutations have significant implications for ocular surface disease models, particularly dry eye disease. The methodological approach to studying these implications involves:

  • Comprehensive phenotypic characterization:

    • Awat1 KO mice exhibit mild dry eye phenotypes

    • Key parameters include increased blinking frequency (3.8 vs 2.6 blinks/min in wild-type)

    • Reduced tear film stability as measured by tear breakup time

    • Progressive corneal surface changes

  • Age-dependent phenotype progression:

    • Unlike Awat2 KO mice that show severe symptoms at all ages tested

    • Awat1 KO mice show milder, but progressive symptoms

    • This makes Awat1 KO models particularly valuable for studying early stages or milder forms of dry eye disease

  • Lipid supplementation experiments:

    • Therapeutic potential can be assessed by topical application of specific lipid species depleted in Awat1 KO mice

    • Formulation challenges include stability and delivery of these hydrophobic compounds to the ocular surface

    • Effectiveness can be measured through improvements in tear film stability and corneal staining scores

The distinctive phenotype of Awat1 KO mice makes them valuable for modeling specific subtypes of meibomian gland dysfunction and dry eye disease, potentially leading to targeted therapeutic approaches based on the specific lipid deficiencies observed .

How conserved is Awat1 function across different mammalian species?

Awat1 function shows significant conservation across mammalian species, though with some important species-specific variations. Methodological approaches to studying this conservation include:

  • Sequence homology analysis: Human AWAT1 and mouse Awat1 share substantial sequence identity and similar genomic organization, with both located on the X chromosome .

  • Expression pattern comparisons: Across species, Awat1 expression is predominantly in sebaceous glands and meibomian glands, reflecting conserved tissue-specific roles .

  • Functional complementation studies: Human AWAT1 can functionally complement mouse Awat1 in transfection experiments, suggesting conservation of enzymatic function.

  • Substrate preference profiling: While the basic catalytic function is conserved, subtle differences in substrate preferences may exist between species, reflecting adaptations to different environmental conditions and physiological requirements.

This conservation makes mouse models particularly valuable for understanding the potential roles of AWAT1 in human ocular surface homeostasis and disease, though species-specific differences in meibum composition should be considered when translating findings .

How can Awat1 research inform therapeutic approaches for dry eye disease?

Research on Awat1 has significant implications for developing novel therapeutic approaches for dry eye disease, particularly those targeting lipid composition abnormalities. Key methodological considerations include:

  • Targeted lipid replacement strategies:

    • Based on the specific lipid deficiencies in Awat1 KO mice ((O-acyl)-ω-hydroxy fatty acids and type 1ω wax diesters)

    • Formulation challenges include delivery of these hydrophobic compounds to the ocular surface

    • Assessment metrics should include tear film stability and corneal epithelial integrity

  • Gene therapy approaches:

    • AAV-mediated delivery of functional Awat1 to meibomian glands

    • Cell-specific promoters to ensure targeted expression

    • Safety and efficacy assessments in Awat1 KO mouse models

  • Small molecule enzyme activators/modulators:

    • High-throughput screening for compounds that enhance remaining Awat1 activity

    • Structure-activity relationship studies to optimize lead compounds

    • Validation in ex vivo meibomian gland cultures and in vivo models

  • Compensatory pathway modulation:

    • Upregulation of Awat2 or other complementary pathways

    • Identification of transcriptional regulators of Awat1/Awat2 expression

    • Testing in models with varying degrees of pathway disruption

The relatively mild phenotype of Awat1 KO mice compared to Awat2 KO suggests that therapeutic strategies targeting Awat2 pathways might be more critical for severe dry eye disease, while Awat1-focused approaches might be more relevant for milder or specific subtypes of the condition .

What expression systems yield optimal recombinant mouse Awat1 activity?

The choice of expression system significantly impacts the yield and functional quality of recombinant mouse Awat1. Based on systematic evaluations, the following methodological approach is recommended:

  • Mammalian expression systems:

    • HEK293 cells provide good expression levels with appropriate post-translational modifications

    • CHO cells offer advantages for large-scale production with stable integration

    • Both systems require optimization of transfection conditions and selection protocols

  • Insect cell systems:

    • Baculovirus-infected Sf9 or High Five cells provide intermediate-scale production

    • Often yield higher protein amounts than mammalian systems

    • May lack some mammalian-specific post-translational modifications

  • Yeast expression systems:

    • Pichia pastoris can be used for larger-scale production

    • Requires optimization of culture conditions and induction protocols

    • Appropriate for biochemical studies but may have differences in glycosylation

  • Bacterial systems:

    • Generally not recommended for full-length Awat1 due to membrane association

    • Can be useful for producing soluble domains for structural studies

    • Requires extensive optimization of solubilization and refolding protocols

For functional studies, mammalian expression systems consistently yield the highest enzymatic activity, though at lower total protein yields than other systems. Codon optimization for the expression host and careful design of purification tags can significantly improve both yield and activity .

What are the critical factors for preserving Awat1 enzymatic activity during purification?

Preserving Awat1 enzymatic activity during purification requires careful attention to several critical factors:

  • Membrane protein handling:

    • Use of appropriate detergents (DDM, CHAPS, or digitonin) at concentrations that solubilize the enzyme while preserving structure

    • Avoidance of harsh detergents like SDS that denature proteins

    • Consideration of lipid reconstitution to maintain a native-like environment

  • Buffer optimization:

    • pH maintenance between 7.0-7.5 throughout purification

    • Inclusion of stabilizing agents such as glycerol (10-20%)

    • Addition of reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

    • Presence of key ions (e.g., Mg²⁺) that may be required for structural stability

  • Temperature control:

    • Performing all purification steps at 4°C

    • Avoiding freeze-thaw cycles by preparing single-use aliquots

    • Controlled freezing rates when storage is necessary

  • Activity assay integration:

    • Regular testing of activity during purification to identify problematic steps

    • Optimization of elution conditions to maximize recovery of active enzyme

    • Use of multiple complementary activity assays to comprehensively evaluate enzyme function

By addressing these factors systematically, it is possible to obtain purified recombinant Awat1 that retains significant enzymatic activity, enabling detailed biochemical and structural characterization studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.