Recombinant Mouse Acyl-CoA wax alcohol acyltransferase 2 (Awat2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Awat2; Dgat2l4; Ws; Acyl-CoA wax alcohol acyltransferase 2; 11-cis-specific retinyl-ester synthase; 11-cis-RE-synthase; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diacylglycerol O-acyltransferase 2-like protein 4; Long-chain-alcohol O-fatty-acyltransferase 2; Wax synthase; mWS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Awat2
Target Protein Sequence
MFWPTKKDLKTAMEVFALFQWALSALVIVTTVIIVNLYLVVFTSYWPVTVLMLTWLAFDW KTPERGGRRFTCVRKWRLWKHYSDYFPLKMVKTKDISPDRNYILVCHPHGLMAHSCFGHF ATDTTGFSKTFPGITPYMLTLGAFFWVPFLRDYVMSTGSCSVSRSSMDFLLTQKGTGNML VVVVGGLAECRYSTPGSTTLFLKKRQGFVRTALKHGVSLIPAYAFGETDLYDQHIFTPGG FVNRFQKWFQKMVHIYPCAFYGRGLTKNSWGLLPYSQPVTTVVGEPLPLPKIENPSEEIV AKYHTLYIDALRKLFDQHKTKFGISETQELVIV
Uniprot No.

Target Background

Function
Acyl-CoA wax alcohol acyltransferase 2 (AWAT2) is an acyltransferase that catalyzes the formation of ester bonds between fatty alcohols and fatty acyl-CoAs, producing wax monoesters. It exhibits a preference for medium-chain acyl-CoAs (C12-C16) and fatty alcohols shorter than C20. AWAT2 also possesses acyl-CoA retinol acyltransferase (ARAT) activity, catalyzing the synthesis of 11-cis-specific retinyl esters. It demonstrates higher catalytic efficiency with 11-cis-retinol compared to 9-cis-retinol, 13-cis-retinol, and all-trans-retinol substrates.
Gene References Into Functions
  1. These data provide experimental support for understanding the regulation of AWAT2 substrate specificity. PMID: 28096191
  2. Transmembrane domains exclude very long-chain fatty acyl-CoAs from the active site of mouse wax synthase. PMID: 26714272
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in Mueller cells of the retina (at protein level). Abundant in tissues rich in sebaceous glands such as the preputial gland and eyelid.

Q&A

What is the physiological role of Awat2 in mammalian systems?

Awat2 catalyzes the final step in WE biosynthesis by esterifying fatty alcohols with acyl-CoA substrates, a process critical for producing meibum lipids that stabilize the tear film . Researchers should validate its function through:

  • Lipidomic profiling of meibomian gland secretions using liquid chromatography-mass spectrometry (LC-MS) to quantify WE species (e.g., C18:1-C24:0 WE)

  • Phenotypic characterization of Awat2 KO mice, including slit-lamp examinations for corneal particulates and meibomian gland orifice obstruction

  • Enzyme activity assays with recombinant Awat2 using radiolabeled substrates (e.g., 14^{14}C-palmitoyl-CoA + C24:0 fatty alcohol)

Which experimental models are suitable for studying Awat2 function?

Primary models include:

  • Conditional KO mice (e.g., Awat2/Y^{-/Y} males and Awat2/^{-/-} females) showing 85-90% reduction in WEs compared to wild types

  • Ex vivo meibomian gland cultures treated with PPARγ agonists to induce lipid synthesis

  • Recombinant protein systems using HEK293 cells transfected with mouse Awat2 cDNA for substrate specificity studies

Key validation metrics:

ModelWE ReductionOcular Phenotype Severity
Awat2 KO mice85-90%Severe dry eye
Awat1/Awat2 DKO95%Gland obstruction

How is Awat2 expression quantified in biological samples?

A three-pronged approach ensures accuracy:

  • qRT-PCR with primers spanning exon junctions (e.g., exon 5 for mouse Awat2)

  • Western blotting using antibodies against the C-terminal domain (UniProt Q8BUR5)

  • Functional assays measuring WE synthesis rates in tissue homogenates

How should researchers resolve contradictions in reported lipid profiles across Awat2 studies?

Discrepancies in WE quantification (e.g., 30-48% WE in human vs. 14-15% in rabbit meibum) arise from:

  • Species-specific differences: Mouse models show near-total WE loss in Awat2 KO , while rabbit cultures retain trace WEs

  • Analytical sensitivity: LC-MS parameters must detect <0.1 pmol WE species using C30 columns and APCI ionization

  • Compensatory mechanisms: Awat1 mRNA increases 1.8-fold in Awat2 KO mice, partially offsetting WE deficits

Recommended workflow:

  • Cross-validate findings using orthogonal methods (e.g., thin-layer chromatography + MALDI-TOF)

  • Control for circadian rhythm effects by collecting samples at Zeitgeber time 6

  • Use isotopic tracers (13^{13}C-acetate) to track de novo WE synthesis rates

What experimental designs mitigate confounding factors in Awat2 KO studies?

Critical considerations include:

  • Sex-specific effects: Awat2 is X-linked; use littermate-controlled cohorts of hemizygous males and homozygous females

  • Age stratification: Analyze mice at 3-6 weeks (acute WE loss) vs. 22-26 months (age-related gland degeneration)

  • Environmental controls: Maintain humidity at 50-55% to prevent compounded dry eye effects

Table 2: Age-Dependent Phenotypes in Awat2 KO Mice

Age GroupBlinking Frequency (events/min)Meibum Tm (°C)
3 weeks2.1 ± 0.332.5 ± 1.2
6 months4.8 ± 0.638.9 ± 0.9

Why do in vitro models fail to recapitulate Awat2 expression, and how can this be addressed?

Current limitations stem from:

  • Loss of 3D gland architecture: Primary rabbit meibocytes show -16.9 log2 fold AWAT2 decrease vs. tissue

  • Insufficient differentiation cues: PPARγ agonists alone fail to induce AWAT2 in immortalized cells

Protocol improvements:

  • Incorporate air-liquid interface culture with BMP-4 supplementation

  • Co-culture with trigeminal ganglion neurons to mimic innervation

  • Use microfluidic chips simulating eyelid mechanical pressure

How does Awat2 interact with other lipid synthesis enzymes?

Awat2 operates within a coordinated network:

  • Upstream: Fatty acyl-CoA reductases (FAR1/2) provide fatty alcohol substrates

  • Parallel: DGAT1 synthesizes diacylglycerols competing for acyl-CoA pools

  • Feedback regulation: WE deficiency upregulates Elovl4 (very-long-chain FA elongase) by 3.2-fold

Experimental strategy:

  • Perform co-immunoprecipitation with epitope-tagged Awat2/FAR2

  • Use siRNA knockdowns to map lipid flux through alternative pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.