Recombinant Mouse Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 (Lpgat1)

Shipped with Ice Packs
In Stock

Description

Introduction

Lysophosphatidylglycerol acyltransferase 1 (LPGAT1) is an enzyme involved in the remodeling of fatty acyl chains in glycerophospholipids within the endoplasmic reticulum membrane . It functions as an acyltransferase, catalyzing the transfer of an acyl-CoA moiety to lysophosphatidylglycerol (LPG) to form phosphatidylglycerol (PG) . Initially, it was believed that LPGAT1 remodeled PG, an intermediate in the cardiolipin (CL) pathway, but this was found to be inconsistent with its location in the endoplasmic reticulum and its preference for saturated acyl-CoAs .

Tissue Expression and Subcellular Localization

Mouse LPGAT1 exhibits high expression levels in the liver and is also present in several other tissues . Subcellular fractionation and immunohistochemical analyses have localized LPGAT1 to the endoplasmic reticulum, which is consistent with its proposed microsomal origin .

4.1. Acyltransferase Activity

Studies have confirmed that LPGAT1 possesses acyltransferase activity. When mouse LPGAT1 was expressed in CHO cells, it exhibited a five-fold higher monoacylglycerol acyltransferase (MGAT) activity compared to cells transfected with an empty vector, indicating its role in triacylglycerol synthesis .

4.2. Substrate Specificity

Recombinant human LPGAT1 recognizes various acyl-CoAs and LPGs as substrates, but it shows a clear preference for long-chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors . Kinetic analyses revealed that oleoyl-LPG is preferred over palmitoyl-LPG as an acyl receptor, and oleoyl-CoA is favored over lauroyl-CoA as an acyl donor . Furthermore, bacterially expressed murine LPGAT1 transferred saturated acyl-CoAs specifically into the sn-1 position of lysophosphatidylethanolamine (LPE) rather than lysophosphatidylglycerol and preferred stearoyl-CoA over palmitoyl-CoA as the substrate .

4.3. Role in Lipid Metabolism

LPGAT1 plays a crucial role in regulating lipid metabolism. Genetic ablation of LPGAT1 in mice resulted in the abolishment of 1-LPE:stearoyl-CoA acyltransferase activity and a shift from stearate to palmitate species in phosphatidylethanolamine (PE), dimethyl-PE, and phosphatidylcholine . This suggests that LPGAT1 controls the stearate/palmitate ratio in these phospholipids by acting as an sn-1 specific acyltransferase .

4.4. Impact on Lung Adenocarcinoma (LUAD)

LPGAT1 is upregulated in lung adenocarcinoma (LUAD) tissues and is associated with an unfavorable prognosis in LUAD patients . Knockdown of LPGAT1 has been shown to abrogate tumor growth and proliferation in both cell and animal models, indicating that LPGAT1 promotes proliferation and inhibits apoptosis in LUAD .

Role in sn-1 Acyl Chain Remodeling

LPGAT1 functions as an sn-1 specific acyltransferase that controls the stearate/palmitate homeostasis of PE and the metabolites of the PE methylation pathway . It works in tandem with a phospholipase A1 to regulate the acyl chain profiles at the sn-1 position of phospholipids .

6.1. Obesity and Longevity

LPGAT1 knockout mice were found to be leaner and had a shorter lifespan compared to their littermate controls, suggesting that LPGAT1 plays a role in regulating body fat content and longevity . Total lipid synthesis was also reduced in isolated hepatocytes of LPGAT1 knockout mice .

6.2. Cancer

The upregulation of LPGAT1 in LUAD and its impact on tumor growth and proliferation suggest that it may be a potential therapeutic target for lung cancer .

Tables

Table 1: MGAT Activity of Recombinant LPGAT1

Enzyme ActivityEmpty VectorLPGAT1 Transfected Cells
MGATX5X

Note: MGAT activity was measured in cell lysates from CHO cells transfected with either an empty vector or LPGAT1 cDNA .

Table 2: Impact of LPGAT1 Knockdown on LUAD Cells

AssayControl GroupLPGAT1-Knockdown Group
Cell ProliferationHighLow
Apoptosis RateLowHigh
Tumor GrowthHighLow

Note: Data from in vitro and in vivo studies on LUAD cells with and without LPGAT1 knockdown .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Lpgat1; Fam34a; Acyl-CoA:lysophosphatidylglycerol acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase LPGAT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Lpgat1
Target Protein Sequence
MAVTVEEAPWLGWIVAKALMRFAFMVANNLVAIPSYICYVIILQPLRVLDSKRFWYIEGL MYKWLLGMVASWGWYAGYTVMEWGEDIKAIAKDEAVMLVNHQATGDVCTLMMCLQDKGPV VAQMMWLMDHIFKYTNFGIVSLIHGDFFIRQGRAYRDQQLLVLKKHLEHNYRSRDRKWIV LFPEGGFLRKRRETSQAFAKKNNLPFLTHVTLPRFGATNIILKALVARQENGSPAGGDAR GLECKSRGLQWIIDTTIAYPKAEPIDIQTWILGYRKPTVTHVHYRIFPIGDVPLETEDLT SWLYQRFIEKEDLLSHFYKTGAFPPPQGQKEAVCREMTLSNMWIFLIQSFAFLSGYLWYH IIQYFYHCLF
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from an acyl-CoA to lysophosphatidylglycerol (LPG), a key step in phosphatidylglycerol biosynthesis. Phosphatidylglycerol serves as a precursor for cardiolipin. While it utilizes various acyl-CoAs and LPGs as substrates, it exhibits a preference for long-chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors, and for oleoyl-LPG over palmitoyl-LPG as an acyl acceptor. Furthermore, it can also catalyze acyl group transfer from an acyl-CoA to monoacylglycerol, producing diacylglycerol, a precursor for triacylglycerol synthesis. This enzyme plays a role in hepatic triacylglycerol synthesis and secretion, showing a preference for sn-2-monoacylglycerol over rac-1-monoacylglycerol as an acyl acceptor.
Gene References Into Functions
  1. LPGAT1, a newly identified MGAT enzyme, plays a significant role in hepatic triacylglycerol synthesis and secretion in db/db mice. PMID: 20018982
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in heart, kidney, liver, skin, intestine, and thymus.

Q&A

What is the primary function of Lpgat1?

Lpgat1 (Acyl-CoA:lysophosphatidylglycerol acyltransferase 1) is a lysophospholipid acyltransferase that catalyzes the remodeling of phosphatidylglycerol (PG) by transferring acyl groups from acyl-CoA to lysophosphatidylglycerol (LPG). Beyond its activity with LPG, research has demonstrated that Lpgat1 possesses acyltransferase activities toward other lysophospholipids including lysophosphatidylinositol (LPI) . The enzyme demonstrates substrate preferences, recognizing various acyl-CoAs and LPGs as substrates while showing clear preference for long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors. It also prefers oleoyl-LPG over palmitoyl-LPG as an acyl receptor .

Where is Lpgat1 primarily localized within cells?

Subcellular localization studies have revealed that Lpgat1 is primarily localized at the mitochondria-associated membranes (MAM), which represent a primary site for phospholipid remodeling . This strategic positioning is consistent with Lpgat1's role in modifying mitochondrial phospholipids that influence membrane characteristics and organelle function. Research has also found that analysis of Lpgat1 cDNA from human preadipocytes identified an additional exon whose sequence could potentially serve as a mitochondrial targeting peptide , further supporting its association with mitochondrial function.

How does Lpgat1 contribute to phospholipid metabolism?

Lpgat1 contributes to phospholipid diversity by catalyzing the reacylation step in the Lands cycle, which is responsible for phospholipid remodeling. This process is critical for attaining appropriate fatty acid compositions in membrane phospholipids. Research has shown that Lpgat1 influences the acyl chain profiles of multiple phospholipids, including phosphatidylcholine (PC), phosphatidylethanolamine (PE), and phosphatidylserine (PS) in skeletal muscle . Knockout studies have demonstrated that LPGAT1 deficiency decreases the incorporation of stearate into phospholipids and alters the balance between palmitate-containing and stearate-containing phospholipid species .

What are the recommended methods for assessing Lpgat1 enzymatic activity in vitro?

For reliable assessment of Lpgat1 enzymatic activity, membrane preparations from cells overexpressing the enzyme provide a robust experimental system. As demonstrated in studies with human ALCAT1 (another lysophospholipid acyltransferase), membrane preparations from human embryonic kidney 293 (HEK293) cells overexpressing the enzyme can be used to measure acyltransferase activities toward various lysophospholipid substrates .

The activity assay typically involves:

  • Preparation of membrane fractions from cells overexpressing recombinant Lpgat1

  • Incubation of membrane preparations with lysophospholipid substrates (LPG or LPI) and various fatty acyl-CoAs

  • Extraction of lipids using appropriate solvent systems

  • Analysis of reaction products using thin-layer chromatography or liquid chromatography-mass spectrometry

For kinetic studies to determine enzyme affinities, varying concentrations of either the lysophospholipid substrate or the acyl-CoA donor are used while keeping the other substrate constant .

What strategies are effective for studying Lpgat1 function in vivo?

Several complementary approaches have proven effective for investigating Lpgat1 function in vivo:

Genetic Manipulation Models:

  • Whole-body knockout mice: Complete deletion of Lpgat1 has been used to investigate systemic effects on metabolism

  • Tissue-specific knockouts: Can help delineate tissue-specific roles of Lpgat1

  • Overexpression models: For example, PGC-1α transgenic mice show upregulation of Lpgat1 in skeletal muscle

Analytical Methods:

  • Lipidomic analysis to profile phospholipid species (using LC-MS/MS)

  • Phospholipid fatty acid composition analysis to determine changes in acyl chain profiles

  • Metabolic phenotyping (glucose tolerance tests, insulin tolerance tests)

  • Tissue histology and immunohistochemistry to assess pathological changes

Functional Assessments:

  • Mitochondrial function tests (oxygen consumption, ATP production)

  • Insulin signaling pathway analysis (measuring phosphorylation of Akt and GSK3α/β)

  • Lipid droplet quantification and characterization

What are the critical considerations when designing experiments with recombinant mouse Lpgat1?

When working with recombinant mouse Lpgat1, researchers should consider:

  • Expression System Selection: The choice between bacterial, insect, or mammalian expression systems affects protein folding and post-translational modifications. Mammalian systems often provide better functional fidelity for enzymes involved in lipid metabolism.

  • Substrate Specificity Analysis: Comprehensive testing with various lysophospholipid acceptors and acyl-CoA donors is essential, as Lpgat1 has demonstrated activity toward multiple substrates with different affinities .

  • Protein Tagging Strategy: Consider whether N-terminal or C-terminal tags might interfere with enzyme activity or subcellular localization, particularly given Lpgat1's mitochondrial targeting sequence .

  • Appropriate Controls: Use of enzymatically inactive mutants as negative controls. Critical amino acids D168 and L169 within ALCAT1 (another acyltransferase) have been identified as potentially involved in lysophospholipid substrate binding , suggesting similar residues in Lpgat1 could be mutated for creating inactive controls.

  • Physiological Relevance: Ensure substrate concentrations and reaction conditions reflect physiological environments when possible.

  • Species Differences: Consider that while mouse and human LPGAT1 share high sequence identity (typically around 86%) , there may be functional differences requiring validation across species.

How does Lpgat1 contribute to hepatic lipid metabolism and NAFLD development?

Lpgat1 plays a critical role in hepatic lipid metabolism, with its deficiency leading to significant metabolic perturbations:

Effects on Lipid Accumulation:

  • LPGAT1 deficiency significantly increases liver weight and the content of both hepatic triglyceride and cholesterol in both male and female mice

  • LPGAT1-deficient mice develop spontaneous hepatosteatosis (fatty liver), which is exacerbated by feeding with a high-fat diet (HFD)

  • Oil red O staining of liver sections confirms increased lipid accumulation in LPGAT1-deficient mice

Mechanisms of Dysregulation:

  • LPGAT1 deficiency down-regulates genes required for lipolysis, including CGI-58 and adiponutrin

  • LPGAT1 deficiency alters expression of key lipid metabolism regulators, including PPARα, SREBP1c, and ACC1 in primary hepatocytes

  • Lipid droplet size is increased in LPGAT1-deficient hepatocytes under both basal conditions and in response to oleic acid treatment

Pathological Consequences:

  • LPGAT1 deficiency causes hepatopathy with dilated hepatic venules that become obstructed by massive accumulation of fat droplets in response to a high-fat diet

  • These liver abnormalities resemble those seen in MEGDEL syndrome, a rare genetic disorder

What is known about Lpgat1's role in obesity and insulin resistance?

Research has revealed complex and sometimes contradictory relationships between Lpgat1 and obesity phenotypes:

Genetic Association Studies:

  • Genome-wide association studies in Pima Indians identified LPGAT1 variants among the top signals associated with BMI

  • A novel 27bp deletion in the 5'-untranslated region of LPGAT1 showed strong association with BMI in full-heritage Pima Indians

  • In vitro functional studies suggest this deletion may affect transcriptional or posttranscriptional regulation

Phenotypes in Knockout Models:

  • Contrary to human association studies, LPGAT1-deficient mice were protected from diet-induced obesity (DIO) with significantly lower fat mass relative to wild-type controls

  • Despite resistance to obesity, LPGAT1-deficient mice developed glucose intolerance in response to a high-fat diet

  • Insulin resistance in these mice was not caused by typical obesity-associated hyperinsulinemia

Insulin Signaling Effects:

  • LPGAT1 deficiency significantly impaired insulin signaling in the liver, shown by decreased insulin-stimulated Akt and GSK3α/β phosphorylation

  • Similar impairment of insulin signaling was observed in cultured primary hepatocytes from LPGAT1-deficient mice

  • Interestingly, LPGAT1 deficiency did not significantly affect insulin signaling in other metabolic tissues like skeletal muscle

These contradictory findings between human genetic studies and mouse models suggest complex tissue-specific and potentially species-specific roles for Lpgat1 in metabolic regulation.

How does Lpgat1 influence mitochondrial function?

Lpgat1 influences mitochondrial function through its role in phospholipid remodeling, particularly affecting cardiolipin (CL) composition:

Effects on Cardiolipin Composition:

  • LPGAT1 deficiency significantly depletes the content of linoleic acid (C18:2), the major fatty acyl component of cardiolipin in metabolic tissues

  • This leads to a significant decrease in tetra-linoleoyl cardiolipin (TLCL) levels in the liver, a common defect associated with NAFLD, obesity, heart failure, and other aging-related diseases

Mitochondrial Membrane Integrity:

  • The proper composition of mitochondrial phospholipids is essential for maintaining membrane integrity and supporting the function of respiratory complexes

  • Alterations in cardiolipin composition due to LPGAT1 deficiency likely contribute to mitochondrial dysfunction observed in metabolic diseases

Localization at Mitochondria-Associated Membranes (MAM):

  • LPGAT1 is localized primarily at MAM, which represents a critical interface between the endoplasmic reticulum and mitochondria and serves as a primary site for phospholipid remodeling

  • This strategic localization supports Lpgat1's role in maintaining proper mitochondrial phospholipid composition

What is the relationship between Lpgat1 and muscle fiber type-specific phospholipid composition?

Recent research has uncovered intriguing relationships between Lpgat1 expression, muscle fiber types, and phospholipid composition:

Fiber Type-Specific Phospholipid Profiles:

  • Fast-twitch muscle (extensor digitorum longus, EDL) and slow-twitch muscle (soleus) show distinct phospholipid compositions

  • In EDL muscle, the vast majority (93.6%) of phosphatidylcholine (PC) molecules are palmitate-containing PC (16:0-PC)

  • In soleus muscle, in addition to 16:0-PC, 27.9% of PC molecules are stearate-containing PC (18:0-PC)

  • 18:0-PC is found predominantly in type I and IIa muscle fibers

Lpgat1 Expression Patterns:

  • Lpgat1 is highly expressed in soleus compared to EDL muscle

  • Peroxisome proliferator-activated receptor γ coactivator-1α (PGC-1α), a master regulator of mitochondrial biogenesis and slow-twitch muscle phenotype, upregulates Lpgat1 expression

Functional Evidence from Knockout Studies:

  • Lpgat1 knockout decreases the incorporation of stearate into PC and PE both in vitro and ex vivo

  • Lpgat1 deficiency reduces the amount of 18:0-PC and 18:0-PE in mouse skeletal muscle while increasing 16:0-PC and 16:0-PE levels

  • Additionally, Lpgat1 knockout decreases stearate-containing phosphatidylserine (18:0-PS)

These findings suggest that Lpgat1 plays a crucial role in establishing and maintaining the fiber type-specific phospholipid composition in skeletal muscle, particularly the incorporation of stearate into various phospholipid classes.

What are the molecular mechanisms underlying Lpgat1's substrate specificity and enzymatic function?

Understanding the molecular basis of Lpgat1's function involves detailed analysis of its structure-function relationships:

Critical Amino Acid Residues:

  • Studies with ALCAT1, another member of the acyltransferase family, have identified critical amino acids D168 and L169 that are potentially involved in lysophospholipid substrate binding

  • These findings provide important clues for investigating analogous residues in Lpgat1 that may determine its substrate specificity

Substrate Preferences:

  • Lpgat1 demonstrates clear preferences for certain substrates, favoring:

    • Long chain saturated fatty acyl-CoAs and oleoyl-CoA as acyl donors

    • Oleoyl-LPG over palmitoyl-LPG as an acyl receptor

  • These preferences contribute to the specific phospholipid profiles generated in different tissues

Enzymatic Mechanisms:

  • Lpgat1 is involved in the Lands cycle for phospholipid remodeling, which involves:

    • Hydrolysis of an existing fatty acid from a phospholipid by phospholipase A2

    • Reacylation of the resulting lysophospholipid by acyltransferases like Lpgat1

  • Kinetic studies suggest that the binding affinity toward lysophospholipids like LPI depends on the fatty acyl-CoA present , indicating complex cooperative interactions between the two substrates

How might Lpgat1 be therapeutically targeted in metabolic diseases?

Based on current research, several potential therapeutic approaches targeting Lpgat1 could be considered for metabolic diseases:

Modulation Strategies:

  • Enzyme Inhibition: Developing specific inhibitors of Lpgat1 might help prevent excessive lipid accumulation in the liver, given that LPGAT1 deficiency protected against diet-induced obesity in mice

  • Tissue-Specific Activation: Selectively enhancing Lpgat1 activity in skeletal muscle might promote a metabolically beneficial phospholipid composition associated with slow-twitch muscle fibers

  • Regulation of Expression: Targeting transcriptional regulators like PGC-1α could indirectly modulate Lpgat1 expression levels

Disease-Specific Considerations:

Disease ConditionPotential Lpgat1-Based ApproachScientific Rationale
ObesityLiver-specific inhibitionLPGAT1-deficient mice showed protection from diet-induced obesity
NAFLD/NASHRestoration of proper cardiolipin compositionLPGAT1 deficiency depleted tetra-linoleoyl cardiolipin, associated with NAFLD
Insulin ResistanceTissue-specific modulationLPGAT1 deficiency impaired insulin signaling specifically in liver but not in skeletal muscle
Mitochondrial DysfunctionEnhancing linoleic acid incorporation into cardiolipinLPGAT1 influences linoleic acid content in cardiolipin, critical for mitochondrial function

Challenges to Consider:

  • The contradictory findings between human genetic studies (where LPGAT1 variants were associated with obesity) and mouse models (where deficiency protected against obesity) suggest complex species-specific effects

  • Tissue-specific roles of Lpgat1 necessitate careful targeting to avoid unintended consequences

  • Alterations in phospholipid composition may have wide-ranging effects beyond the intended metabolic outcomes

What are common challenges in expressing and purifying functional recombinant mouse Lpgat1?

Researchers frequently encounter several challenges when working with recombinant Lpgat1:

Expression System Challenges:

  • As a membrane-associated enzyme, Lpgat1 may show reduced solubility and incorrect folding in bacterial expression systems

  • Mammalian expression systems often yield properly folded protein but at lower quantities

  • The presence of potential mitochondrial targeting sequences may complicate full-length protein expression

Purification Considerations:

  • Membrane protein purification requires careful detergent selection to maintain enzymatic activity

  • Tag placement (N-terminal vs. C-terminal) may affect enzyme activity or localization

  • Protein stability during purification can be problematic, potentially requiring inclusion of specific phospholipids in buffers

Functional Validation:

  • Confirming enzymatic activity of purified recombinant Lpgat1 requires appropriate substrate availability

  • Establishing reliable activity assays that distinguish between various acyltransferase activities

  • When using recombinant fragments (such as control fragments spanning amino acids 193-338) , ensuring they maintain native binding properties

How can researchers address contradictory findings between different model systems studying Lpgat1?

The contradictions observed between human genetic studies and mouse models of Lpgat1 function highlight important considerations for researchers:

Reconciliation Strategies:

  • Species-Specific Differences:

    • Compare protein sequences and identify divergent domains

    • Examine expression patterns in homologous tissues across species

    • Consider evolutionary differences in metabolic regulation

  • Genetic Background Effects:

    • Use multiple mouse strains to verify phenotypes

    • Consider conditional knockout models to minimize developmental compensation

    • Implement tissue-specific manipulations to isolate effects

  • Environmental and Experimental Factors:

    • Standardize diet composition and feeding protocols

    • Control for age, sex, and housing conditions

    • Document precise experimental timelines

  • Comprehensive Phenotyping:

    • Employ multiple complementary methodologies to assess phenotypes

    • Measure parameters at multiple time points to capture dynamic changes

    • Include detailed lipidomic analyses to understand biochemical impacts

Case Example: Obesity Phenotype Discrepancy

Human StudiesMouse StudiesReconciliation Approach
LPGAT1 variants associated with increased BMI in Pima Indians LPGAT1-deficient mice protected from diet-induced obesity Examine tissue-specific expression and activity patterns across species
27bp deletion in 5'-UTR associated with obesity Lower fat mass in knockout mice despite glucose intolerance Investigate partial vs. complete loss of function effects
Effect potentially mediated through transcriptional regulation Metabolic effects mediated through altered phospholipid composition Analyze detailed lipidomic profiles in human samples with variant genotypes

What are the latest methodological advances in studying Lpgat1-mediated phospholipid remodeling?

Recent technological developments have enhanced our ability to study Lpgat1 function:

Advanced Analytical Techniques:

  • High-resolution lipidomics using liquid chromatography-tandem mass spectrometry (LC-MS/MS) for detailed phospholipid profiling

  • Position-specific analysis to determine fatty acid distribution at the sn-1 and sn-2 positions of glycerophospholipids

  • Isotope labeling approaches to track fatty acid incorporation and phospholipid remodeling rates

Genetic Engineering Approaches:

  • CRISPR-Cas9 technology for precise genome editing to create cell and animal models

  • Conditional knockout systems using Cre-loxP for tissue-specific and temporal control of gene expression

  • Creation of point mutations to study structure-function relationships

Imaging and Localization Methods:

  • Super-resolution microscopy to visualize subcellular localization at mitochondria-associated membranes

  • Live-cell imaging with fluorescent phospholipid analogs to track remodeling in real-time

  • Proximity labeling methods to identify protein interaction partners in native cellular environments

Functional Assessment Tools:

  • Seahorse analyzer for measuring mitochondrial respiratory function in relation to phospholipid composition

  • Membrane fluidity and dynamic assessments to understand the biophysical consequences of altered phospholipid profiles

  • Combined proteomics and lipidomics approaches to link changes in enzyme expression with lipid composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.