Recombinant Mouse Adenosine receptor A2b (Adora2b)

Shipped with Ice Packs
In Stock

Description

Anti-Inflammatory Regulation

  • Adora2b activation enhances regulatory T cell (Treg) differentiation, suppressing endotoxin-induced pulmonary inflammation .

  • In Adora2b<sup>−/−</sup> mice, impaired Treg induction exacerbates inflammation, increasing leukocyte recruitment and vascular leakage .

Metabolic and Cellular Effects

  • A2B receptor activation in macrophages and endothelial cells stimulates IL-6 production, linked to insulin resistance in diabetic models .

  • Blocking Adora2b in diabetic mice reduces hepatic glucose production and improves glucose uptake in muscle and adipose tissue .

Pulmonary Function

  • Adora2b is highly expressed in type II alveolar epithelial cells (89-fold higher mRNA than leukocytes), where it induces cAMP accumulation more potently than β-adrenergic agonists .

Key Pharmacological Agents

CompoundFunctionSelectivity (Mouse A2B vs. Other Subtypes)Source
ATL-802Antagonist>900-fold selectivity
NECANonselective agonistLow affinity (K<sub>i</sub> >100 nM)

Recombinant Expression Systems

  • HEK-293 cells transfected with mouse Adora2b are used for radioligand binding assays (e.g., [<sup>3</sup>H]ATL-852; K<sub>d</sub> = 28.5 nM) .

  • Fluorescence-activated cell sorting (FACS) of SP-C-eGFP transgenic mice enables isolation of Adora2b-expressing type II alveolar cells for functional studies .

Disease Associations

ConditionMechanismReference
Pulmonary InflammationImpaired Treg induction in Adora2b<sup>−/−</sup> mice
Insulin ResistanceA2B-mediated IL-6 production in macrophages
AsthmaDysregulated adenosine signaling

cAMP Signaling in Type II Alveolar Cells

  • NECA (adenosine analog) induces a 3.1-fold greater cAMP response in type II cells compared to isoproterenol (β-adrenergic agonist) .

  • ATL-802 completely inhibits this response, confirming Adora2b-specific activity .

Gene Expression Profiles

Cell TypeAdora2b mRNA Level (Relative to Leukocytes)
Type II Alveolar Cells89-fold higher
Alveolar MacrophagesModerate

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is preferred, please communicate with us in advance, as additional charges may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please let us know, and we will prioritize developing the specified tag.
Synonyms
Adora2b; Adenosine receptor A2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHKIISRYVLCQAETKGGSGQAGAQSTLSLGL
Uniprot No.

Target Background

Function
Adenosine receptor A2b is a G protein-coupled receptor that binds adenosine. Activation of this receptor leads to the stimulation of adenylyl cyclase, ultimately influencing various cellular processes.
Gene References Into Functions
  1. Obesity is associated with colonic inflammation, which results in increased expression of Adora2b. By modulating the activity of excitatory tachykininergic nerves, Adora2b contributes to the enteric dysmotility observed in obesity. PMID: 28808842
  2. Research suggests that Adora2b stimulation inhibits the activation of ERK1/2, p38, and NF-kappaB by RANKL, suppressing the induction of osteoclast marker genes. This action ultimately contributes to reduced osteoclast cell-cell fusion and bone resorption activity. PMID: 29047264
  3. The pivotal role of CXCR4- and CXCR7-inhibition in acute pulmonary inflammation, reliant on Adora2b receptor signaling, has been reported. PMID: 28542132
  4. Adora2b stimulation promotes FGF2 and CXCL12 expression in FAP-positive melanoma-associated fibroblasts, contributing to the formation of a tumor-promoting microenvironment. PMID: 27590504
  5. Activation of adenosine A2b receptors on myeloid cells causes nociceptor hyperexcitability and promotes chronic pain via soluble IL-6 receptor trans-signaling. PMID: 27320922
  6. Findings indicate that hypoxia, through HIF1A, contributes to the development and progression of pulmonary fibrosis by regulating Adora2b expression on alternatively activated macrophages, influencing cell differentiation, and the production of profibrotic mediators PMID: 28701304
  7. Studies have demonstrated that signaling through hepatocellular Adora2b adenosine receptors mitigates IR injury of the liver. PMID: 27404219
  8. Diabetes is associated with increased A2A/A2B receptor expression in coronary arteries, leading to enhanced A2A/A2B-mediated increases in coronary flow observed in diabetic hearts. PMID: 26654777
  9. Adenosine A2B receptor-induced VEGF production and angiogenesis are implicated in myeloid-derived suppressor cells within a mouse melanoma model. PMID: 26317647
  10. Angiotensin II stimulation alters vasomotor response to adenosine in mouse mesenteric artery, with a role for A1 and A2B adenosine receptors. PMID: 26227882
  11. Research suggests that intestinal epithelial Adora2b signaling provides protection during intestinal inflammation by enhancing mucosal barrier responses. PMID: 25850656
  12. Exposure of DCs to an Adora2b agonist facilitated gammadelta T cell activation, resulting in augmented Th17 responses and progressive EAU development. PMID: 26147733
  13. IFN-gamma priming of macrophages selectively prevents the induction of the Adora2b receptor in macrophages, thereby mitigating sensitivity to adenosine and preventing a regulatory transition. PMID: 26355158
  14. These findings suggest that tissue-specific targeting of Adora2b is desirable when employing Adora2b agonists for the prevention or treatment of myocardial ischemia. PMID: 26136425
  15. Alveolar epithelial A2B adenosine receptor signaling contributes to lung protection, implicating inhaled A2B adenosine receptor agonists in ALI treatment. PMID: 26188061
  16. The adenosine A2b receptor was shown to be the sole adenosine receptor whose cardiac expression is induced by ischemia in both mice and humans, and its function is implicated in ischemic pre- or post-conditioning. PMID: 24502579
  17. Activation of ADORA2B on macrophages plays a significant role in the pathogenesis of lung fibrosis and pulmonary hypertension. PMID: 25318478
  18. The A2B adenosine receptor (ADORA2B) is essential for adenosine-induced SphK1 activity in human and mouse normal and sickle erythrocytes in vitro. PMID: 25587035
  19. Findings suggest a potentially destructive role for A2BAR under intestinal ischemia/reperfusion and acute hypoxic conditions. PMID: 24966910
  20. This study implicates the A2bAR as a regulator of adipocyte differentiation and the A2bAR-KLF4 axis as a potentially significant modulator of adipose biology. PMID: 24928509
  21. Thus, adenosine acts as a danger-associated molecular pattern (DAMP) that initiates helminth-induced type 2 immune responses through the A2B adenosine receptor. PMID: 24629340
  22. Findings reveal that excess adenosine-mediated ADORA2B signaling underlies reduced penile PDE activity by decreasing PDE5 gene expression in a HIF-1alpha-dependent manner. PMID: 24614760
  23. CD73-dependent production of extracellular adenosine and endothelial Adora2b signaling protect the kidney during diabetic nephropathy. PMID: 24262796
  24. It was found that stimulation of A2B adenosine receptors suppressed free fatty acid-induced deleterious inflammatory and metabolic activation of macrophages. PMID: 24194503
  25. Studies of ventilator-induced lung injury revealed induction of ADORA2B during ALI in vivo, which was abolished following HIF inhibition or genetic deletion of Hif1a. PMID: 24391213
  26. A2B receptor signaling linked to up-regulation of pro-angiogenic factors in cardiac Sca-1(+)CD31(-) stromal cells is essential for overall improvement of cardiac recovery seen after their transplantation to the injured heart. PMID: 23827818
  27. An important role of the A2B receptor-dependent upregulation of JunB in VEGF production and potentially other AP-1-regulated events has been identified. PMID: 24136993
  28. Blockade of ADORA2B attenuates the development of a pulmonary hypertension phenotype, correlating with reduced levels of hyaluronan (HA) deposition in vessels and down-regulation of genes involved in HA synthesis. PMID: 23855769
  29. Data suggest that the crosstalk pathway between ENT2 and alveolar epithelial Adora2b in lung protection during acute lung injury (ALI) opens possibilities for combined therapies targeted to this protein set. PMID: 23603835
  30. Data indicate that CD73 promotes metastasis through the activation of both A2A and A2B receptors. PMID: 23964122
  31. Adenosine regulates bone metabolism via A1, A2A, and A2B receptors. PMID: 23682121
  32. CD73 promotes the production of renal adenosine, which is a prominent driver of renal hypertension by enhanced ADORA2B signaling-mediated endothelin-1 induction in a hypoxia-inducible factor-alpha-dependent manner. PMID: 23584256
  33. Activation of Adenosine A2B receptors in cortical neurons induces leukemia inhibitory factor release. PMID: 22894638
  34. Binding of A(2B)AR to specific sites on p105 prevents polyubiquitylation and degradation of p105 protein. PMID: 22767505
  35. This study identified the A2bAR as a significant regulator of HFD-induced hallmarks of T2D, highlighting its therapeutic potential. PMID: 22848385
  36. A2B adenosine receptor is upregulated in the peripheral lymphoid tissues of experimental autoimmune encephalomyelitis (EAE) mice. PMID: 23225885
  37. T helper (Th)2-type cells demonstrate a predominance for A2B receptor expression by myeloid cells, a mechanism involved in the development of asthma-like pulmonary inflammation. PMID: 22956582
  38. Distinct roles for hematopoietic cell A(2b) receptor in cell trafficking and for endothelial A(2b) receptor for microvascular permeability have been identified. PMID: 22707616
  39. Studies identify adenosine-elicited stabilization of Per2 in the control of HIF-dependent cardiac metabolism and ischemia tolerance, implicating Per2 stabilization in these processes. PMID: 22504483
  40. It is proposed that A2B adenosine receptor activation may be a strategy employed by L. amazonensis to inhibit dendritic cell function and evade the immune response. PMID: 22311598
  41. This study identified a novel regulator of sweet taste, the A2BR, which functions to potentiate sweet responses in posterior lingual taste fields. PMID: 22253866
  42. The A(2b)AR regulates liver SREBP-1, hyperlipidemia, and atherosclerosis. PMID: 22144568
  43. The stimulatory effect of adenosine primarily required A(2B) receptors in activated macrophages. PMID: 21926236
  44. Adora2b receptors are significantly associated with expression of the sweet taste receptor subunit Tas1r2. PMID: 22219293
  45. Blockade of A(2B)ARs enhances DC activation and CXCR3-dependent antitumor responses. PMID: 22116822
  46. Adenosine augmented IL-10 production by stimulating p38 MAPK. Collectively, our results establish that A(2B)ARs augment IL-10 production by activated murine microglia. PMID: 22116830
  47. Both adenosine A(2A) and A(2B) receptors are required for adenosine A(1) receptor-mediated cardioprotection, implicating a role for interactions among receptor subtypes. PMID: 21743001
  48. Lowering adenosine in wild-type mice or genetic deletion of A(2B)R in mutant mice significantly attenuated PI3K/AKT activation, eNOS phosphorylation, and subsequent impaired penile erection. PMID: 21566208
  49. This research suggested a mechanism for putative proinflammatory effects of A(2B)AR. PMID: 21593380

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary signaling mechanism of mouse Adora2b?

Mouse Adora2b functions primarily through G protein-coupled receptor signaling. It activates adenylate cyclase through Gs protein coupling, which increases intracellular cyclic AMP levels. By modulating cAMP levels, Adora2b influences various cellular responses including smooth muscle relaxation and endothelial cell barrier function . This mechanism makes Adora2b a critical regulator of vascular tone and inflammation in multiple tissue contexts.

Where is Adora2b most highly expressed in mouse lung tissue?

The highest expression of Adora2b receptors in the mouse lung has been identified on type II alveolar epithelial cells (AECs). This was demonstrated using β-galactosidase reporter gene expression in Adora2b-/- mice, where the reporter gene was under control of the endogenous Adora2b promoter. Relatively lower expression levels were observed in alveolar macrophages, bronchial epithelial cells, and vascular cells . Highly purified type II AECs have been shown to express 89-fold higher Adora2b mRNA than pulmonary leukocytes, making them the predominant site of Adora2b expression in the mouse lung .

How can Adora2b promoter activity be monitored in mouse models?

Adora2b promoter activity can be effectively monitored using reporter gene approaches. A particularly valuable model is the Adora2b-/- mouse constructed with a β-galactosidase (β-gal) reporter gene under control of the endogenous Adora2b promoter. This allows for quantification of Adora2b promoter activity through histological and flow cytometric analysis of β-gal expression in various cell populations . This approach has been successfully used to identify sites of Adora2b expression in the lung and vasculature of several tissues .

What selective agonists and antagonists are available for mouse Adora2b research?

Several compounds have been developed for Adora2b research:

Agonists:

  • 5'-N-ethylcarboxamidoadenosine (NECA): A non-specific adenosine receptor agonist that has been used in models of pancreatitis and may be involved in tissue regeneration .

Antagonists:

  • ATL-802: A highly potent (Ki = 8.6 ± 2.2 nM) and selective antagonist for mouse Adora2b with excellent selectivity (978-fold over A2AR and >1,000-fold over A1 and A3 receptors) .

  • PSB1115: An Adora2b antagonist that has been used in cancer research models, showing efficacy in decreasing KPC tumor growth and fibrosis in mouse models .

  • MRS1754: A xanthine compound that generally binds with lower potency and selectivity to rodent than human A2B receptors .

The choice between these compounds should be guided by the specific experimental requirements, particularly considering species-specific differences in receptor pharmacology.

What methods are recommended for isolating and studying Adora2b-expressing cells from mouse lung?

For isolating and studying Adora2b-expressing cells, particularly type II alveolar epithelial cells, the following approach has proven effective:

  • Use transgenic mice expressing enhanced green fluorescent protein (eGFP) under control of the surfactant protein C promoter.

  • Prepare single-cell suspensions from lung tissue.

  • Isolate highly purified type II AECs by fluorescence-activated cell sorting (FACS) of eGFP-positive cells.

  • Confirm functionality of Adora2b receptors using cAMP assays with agonists like NECA and selective antagonists like ATL-802 .

This approach allows for functional studies on specific cell populations with high Adora2b expression.

How can researchers accurately measure Adora2b binding affinity in mouse models?

Adora2b binding affinity can be accurately measured using radioligand binding assays. For mouse Adora2b research:

  • Use a specific radioligand such as [³H]ATL-852, which has been shown to bind to mouse Adora2b with a Kd of 28.5 nM .

  • Prepare membranes from cells expressing recombinant mouse Adora2b (e.g., transfected HEK-293 cells).

  • Conduct saturation binding assays to determine Bmax and Kd values.

  • For competition binding assays, use various concentrations of test compounds against the radioligand to determine Ki values .

This methodology provides quantitative data on ligand affinity and receptor density, essential for pharmacological characterization of novel compounds targeting Adora2b.

How does Adora2b signaling affect cardiac ischemia-reperfusion injury?

Adora2b signaling has been shown to play a protective role during cardiac ischemia-reperfusion injury (I/R) by dampening inflammation. Research using Adora2b-/- mice has demonstrated the following mechanisms:

  • Adora2b on bone marrow-derived inflammatory cells is critical for cardioprotection.

  • Polymorphonuclear leukocytes (PMNs) have been identified as the dominant cell type attracted to post-ischemic myocardium.

  • Adora2b agonist treatment upon reperfusion is protective, but only when PMNs are present.

  • The protective effect involves an Adora2b-dependent TNFα release via PMNs .

These findings suggest that therapeutic strategies targeting Adora2b signaling could be beneficial in preventing cardiac damage following ischemic events.

What is the role of Adora2b in cancer progression and metastasis?

Adora2b has emerged as an important factor in cancer progression and metastasis:

  • In experimental models of melanoma and triple-negative breast cancer, Adora2b antagonist treatment significantly decreased metastasis incidence .

  • Genetic deletion of Adora2b in mouse and human triple-negative breast cancer cells reduced their metastatic capability in vivo .

  • In pancreatic ductal adenocarcinoma (PDAC), Adora2b activation may:

    • Reduce adaptive anti-tumor responses

    • Augment immune suppression

    • Contribute to transformation and changes in fibrosis, perineural invasion, or vasculature .

  • Antagonizing Adora2b in gastric cancer cells has been shown to increase the efficacy of cisplatin treatment .

These findings suggest Adora2b as a potential therapeutic target in multiple cancer types, particularly in preventing metastasis.

How does Adora2b expression in type II alveolar epithelial cells influence lung pathophysiology?

The high expression of Adora2b on type II alveolar epithelial cells has significant implications for lung pathophysiology:

  • Functional Adora2b on type II AECs generates substantial cAMP responses when activated - over three times more than maximally activated β-adrenergic receptors .

  • This suggests a potential role in regulating surfactant production, as type II AECs are the primary producers of pulmonary surfactant.

  • The high level of Adora2b expression indicates a possible role in lung inflammatory conditions and response to injury.

  • The strategic position of type II AECs at the air-tissue interface makes Adora2b signaling potentially important in responding to environmental challenges and maintaining alveolar homeostasis .

Further research is needed to fully elucidate how this high expression of Adora2b specifically contributes to lung function and disease processes.

What mouse models are most suitable for studying Adora2b in pancreatic cancer research?

Several mouse models have been identified as useful for studying Adora2b in pancreatic cancer:

  • Syngeneic models: Using subcutaneous or orthotopic implantation of KPC cells into the flank, pancreas, spleen, or any combination of these injection sites. These models are particularly useful for studying treatment options using Adora2b antagonist compounds in primary tumors and metastatic sites .

  • Genetically engineered mouse (GEM) models:

    • KPC model (mutations in K-ras and p53)

    • Pdx:Cre;LsL-KrasG12D (KC) model (mutation in K-ras only)

These models allow for investigation of Adora2b signaling in the context of spontaneously developing pancreatic tumors that recapitulate many aspects of human disease.

How can researchers distinguish between Adora2b effects on immune cells versus tissue-resident cells?

To distinguish between Adora2b effects on different cell populations, the following experimental approaches are recommended:

  • Bone marrow chimera studies: Transplant wild-type (WT) bone marrow into Adora2b-/- mice or Adora2b-/- bone marrow into WT mice. This approach has been successfully used to identify the contribution of inflammatory cells versus tissue-resident cells in Adora2b-mediated cardioprotection .

  • Cell-specific knockouts: Generate conditional knockout mice with cell type-specific deletion of Adora2b.

  • Cell depletion studies: In models such as cardiac ischemia-reperfusion, neutrophil depletion combined with Adora2b agonist treatment has helped identify the specific role of polymorphonuclear leukocytes in Adora2b-mediated protection .

  • Ex vivo studies: Isolate specific cell populations (e.g., purified type II AECs or immune cells) and conduct comparative functional studies to determine cell-autonomous effects of Adora2b signaling .

These approaches provide complementary strategies to delineate the cell type-specific roles of Adora2b.

What are the current limitations in translating mouse Adora2b research to human applications?

Several challenges exist in translating mouse Adora2b research to human applications:

  • Pharmacological differences: Compounds like MRS1754 (xanthine compounds) bind with lower potency and selectivity to rodent than human A2B receptors . This necessitates careful validation of pharmacological tools across species.

  • Expression pattern differences: While some similarities exist, there may be species-specific differences in Adora2b expression patterns and cell type distribution.

  • Signaling pathway variations: Downstream signaling pathways may differ between mouse and human Adora2b, affecting functional outcomes.

  • Disease model limitations: Mouse models of cancer and inflammation may not fully recapitulate the complexity of human disease states, particularly regarding the tumor microenvironment and immune system interactions with Adora2b .

  • Genetic background effects: Variations in genetic background in mouse models can influence Adora2b function and physiological outcomes.

Researchers should be aware of these limitations and consider complementary approaches, including studies with human tissues and cells, when translating findings to potential clinical applications.

How might combination therapies targeting Adora2b improve cancer treatment outcomes?

Emerging research suggests several promising combination approaches:

  • Combination with chemotherapy: Antagonizing Adora2b expression in gastric cancer cells has been shown to increase the efficacy of cisplatin treatment , suggesting potential for combination with standard chemotherapeutic agents.

  • Combination with immunotherapy: Since Adora2b signaling can reduce CD8+ T cell anti-tumor immunity, combining Adora2b antagonists with immune checkpoint inhibitors may enhance tumor-specific immune responses .

  • Targeting the adenosine pathway: Combination approaches targeting multiple components of the adenosine pathway (e.g., CD73 and Adora2b) may provide synergistic effects by more comprehensively blocking the immunosuppressive effects of adenosine in the tumor microenvironment .

  • Anti-fibrotic combinations: In pancreatic cancer, where Adora2b antagonism has been shown to decrease fibrosis, combination with other anti-fibrotic agents may improve drug delivery and effectiveness .

Future clinical trials should evaluate these combination approaches in both neoadjuvant and adjuvant settings, particularly for cancers with poor prognosis like pancreatic ductal adenocarcinoma.

What molecular mechanisms link Adora2b signaling to metastatic potential in cancer cells?

The mechanisms connecting Adora2b to metastasis require further investigation, but current evidence suggests several potential pathways:

  • Immune suppression: Adora2b activation may dampen anti-tumor immune responses, creating a permissive environment for metastatic spread.

  • Epithelial-mesenchymal transition (EMT): By influencing cAMP levels, Adora2b may affect cellular plasticity and promote EMT, a process associated with increased metastatic potential.

  • Vascular permeability: Given its role in endothelial cell barrier function , Adora2b may influence the ability of cancer cells to enter and exit the vasculature during metastasis.

  • Inflammatory signaling: Adora2b-dependent TNFα release, as observed in cardiac models , might create pro-metastatic inflammatory conditions.

  • Cell-autonomous effects: Direct Adora2b signaling in cancer cells could promote survival during circulation and colonization of distant sites .

Understanding these mechanisms will be crucial for developing strategies to specifically target metastasis through Adora2b modulation.

How can new mouse models be optimized to better understand Adora2b biology across different pathological conditions?

To optimize mouse models for comprehensive Adora2b research, consider:

  • Reporter systems: Continue developing and refining reporter systems like the β-galactosidase model to visualize Adora2b expression across tissues and disease states .

  • Conditional and inducible models: Generate tissue-specific and temporally controlled Adora2b knockout or overexpression models to study acute versus chronic effects.

  • Humanized models: Develop mice expressing human Adora2b to better predict pharmacological responses relevant to clinical applications.

  • Combined pathway models: Create models with alterations in multiple components of the adenosine signaling pathway to understand pathway interactions.

  • Disease-specific models: Optimize existing disease models (cancer, inflammation, ischemia) to specifically address Adora2b biology in clinically relevant contexts .

  • Single-cell analytical approaches: Incorporate single-cell transcriptomics and proteomics to better characterize heterogeneous Adora2b responses across cell populations.

These optimized models will facilitate more precise targeting of Adora2b for therapeutic development across multiple disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.