Recombinant Mouse Adenosine receptor A3 (Adora3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Mouse Adora3 is synthesized using the Almost Living Cell-Free Expression System (AliCE®), which leverages plant-derived cellular machinery for high-fidelity protein production . Key steps include:

  • Expression: Optimized for yield and solubility in a tobacco lysate-based system.

  • Purification: Single-step Strep-tag affinity chromatography ensures >70% purity .

  • Storage: Stable at -80°C in PBS with 10% glycerol .

Functional Roles and Signaling Mechanisms

Adora3 regulates physiological processes via Gi/Gq protein coupling, influencing pathways such as:

  • Cardioprotection: Mediates ischemic preconditioning and reduces reperfusion injury .

  • Anti-Inflammation: Inhibits neutrophil degranulation and pro-inflammatory cytokines (e.g., TNF-α, IL-6) .

  • Neuroprotection: Modulates neuronal survival and apoptosis in neurodegenerative models .

Key Findings:

  • A3AR activation reduces infarct size by 60% in mouse myocardial ischemia models .

  • Agonists like CF-101 (Piclidenoson) suppress inflammation in rheumatoid arthritis and psoriasis .

Research Applications

Recombinant Mouse Adora3 is utilized in:

4.1. Mechanistic Studies

  • Ligand Binding: Used to characterize agonists (e.g., CF-101, CF-102) and antagonists (e.g., MRS-1523) .

  • Signal Transduction: Elucidates Gi3/GoA protein activation and downstream cAMP modulation .

4.2. Therapeutic Development

  • Drug Screening: Identifies allosteric modulators for chronic pain and cancer .

  • Antibody Validation: Serves as a positive control in Western blotting (e.g., ab203298 antibody) .

Comparative Insights from Knockout Models

  • A3AR⁻/⁻ Mice: Exhibit enhanced tolerance to ischemia-reperfusion injury, reduced infarct size, and attenuated inflammatory responses .

  • Therapeutic Implications: Deletion of A3AR improves cardiac function but complicates neuroprotective pathways .

Data Tables: Key Ligands and Modulators

Ligand TypeExamplesFunctionReference
AgonistsCF-101, 2-Cl-IB-MECAActivate cardioprotective pathways
AntagonistsMRS-1523, MRS-1220Block inflammation and mast cell activity
Positive Allosteric ModulatorsLUF-6000, MRS-3558Enhance adenosine-induced Gi3 activation

Challenges and Future Directions

  • Species-Specificity: Mouse A3AR shares 85% homology with humans but differs in ligand selectivity (e.g., ECL3 region) .

  • Therapeutic Optimization: Dual-acting modulators targeting intracellular and orthosteric sites may improve drug efficacy .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
Adora3; Gpcr2; Adenosine receptor A3; A3AR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEADNTTETDWLNITYITMEAAIGLCAVVGNMLVIWVVKLNPTLRTTTVYFIVSLALADI AVGVLVIPLAIAVSLQVKMHFYACLFMSCVLLIFTHASIMSLLAIAVHRYLRVKLTVRYR TVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKATLASSQNSSTLLCHFRSVVSLDYMVF FSFITWILVPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFLF ALCWLPLSIINFVSYFDVKIPDVAMCLGILLSHANSMMNPIVYACKIKKFKETYFLILRA VRLCQTSDSLDSNMEQTTE
Uniprot No.

Target Background

Function
Adenosine receptor A3 (Adora3) is a receptor for adenosine. Its activity is mediated by G proteins, which inhibits adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the mouse adenosine A3 receptor and how does it compare to the human ortholog?

The mouse adenosine A3 receptor (A3AR) is a G protein-coupled receptor encoded by the Adora3 gene that responds to the endogenous ligand adenosine. While the fundamental function is conserved between species, there are significant sequence differences between mouse and human A3AR. These differences result in distinct pharmacological profiles, with many antagonists developed for human A3AR showing substantially lower affinity for rodent A3AR . When designing experiments using pharmacological agents, researchers must consider these species-specific differences, as compounds that are selective in humans may show different selectivity profiles in mice. For translational studies, it's essential to validate findings across species using appropriate ligands for each receptor ortholog.

What expression patterns does A3AR exhibit in mouse tissues?

A3AR shows variable expression across mouse tissues, with notable presence in cardiovascular tissues. Studies have demonstrated age-dependent changes in receptor expression, with reduced A3AR mRNA levels observed in aged hearts compared to young hearts . During ischemic conditions, A3AR expression is altered, potentially impacting cardioprotective mechanisms. In experimental contexts, researchers should account for these expression variations by carefully selecting appropriate age groups and control conditions. When working with recombinant A3AR, it's advisable to confirm that expression levels approximate physiological conditions to maintain translational relevance.

How can I effectively validate mouse A3AR knockout models?

Validation of A3AR knockout models requires multiple complementary approaches:

  • Genetic confirmation: Verify the targeted deletion through PCR genotyping

  • Protein expression analysis: Use validated anti-A3AR antibodies to confirm the absence of the receptor protein

  • Functional validation: Measure cAMP levels in tissues like aorta and heart, as A3AR knockout mice typically show elevated steady-state cAMP levels compared to wild-type mice

  • Phenotypic assessment: Evaluate cardiovascular parameters such as response to ischemia-reperfusion injury, where A3AR knockout mice demonstrate improved functional recovery (approximately 80% vs. 51% in wild-types)

What are the key considerations when selecting antibodies for mouse A3AR research?

When selecting antibodies for mouse A3AR research, consider:

  • Species specificity: Ensure the antibody specifically recognizes mouse A3AR rather than human or other species variants

  • Isoform recognition: The mouse A3AR has multiple reported isoforms, so determine whether your research requires an antibody that detects all isoforms or a specific variant

  • Application compatibility: Verify the antibody has been validated for your specific application (Western blot, immunohistochemistry, flow cytometry, etc.)

  • Controls: Include appropriate positive controls (tissues known to express A3AR) and negative controls (A3AR knockout tissues) to validate antibody specificity

  • Cross-reactivity: Check for potential cross-reactivity with other adenosine receptor subtypes, particularly A1AR which shares some structural similarities

How do A3AR agonists and antagonists modulate cardiovascular function in mouse models?

A3AR agonists and antagonists demonstrate complex effects on cardiovascular function that depend on timing of administration, disease context, and genetic background:

In ischemia-reperfusion models, the timing of A3AR modulation is critical. Studies show A3AR agonists can be cardioprotective when administered after the onset of ischemia or during reperfusion . This offers potential for treatment of acute myocardial infarction beyond preconditioning applications.

Paradoxically, studies with A3AR knockout mice demonstrate improved tolerance to ischemia-reperfusion injury, with 60% reduction in infarct size compared to wild-type mice . This suggests that under certain conditions, A3AR activation may actually exacerbate injury. When investigating these contradictory findings, researchers should consider:

  • Timing of receptor modulation (pre-ischemia, during ischemia, or at reperfusion)

  • Specificity of pharmacological agents

  • Potential compensatory mechanisms in knockout models

  • Age-dependent expression changes in A3AR and other adenosine receptors

The adenosine receptor antagonist BW-A1433 decreases functional recovery following ischemia in A3AR knockout mice but not in wild-type mice, highlighting the complex interplay between different adenosine receptor subtypes .

What molecular mechanisms underlie A3AR signaling in cardiac protection or injury?

The molecular mechanisms of A3AR signaling in cardiac contexts involve several interconnected pathways:

  • cAMP modulation: A3AR activation typically leads to decreased cAMP levels through Gi coupling. A3AR knockout mice exhibit elevated cAMP levels in cardiac tissues .

  • Mitochondrial permeability transition pore (mPTP) regulation: A3AR activation inhibits mPTP opening via PI3K/Akt pathway activation and subsequent inhibition of glycogen synthase kinase . This mechanism is particularly relevant for cardioprotection during reperfusion.

  • Inflammatory modulation: A3AR influences mast cell degranulation, which may affect release of vasoactive substances and contribute to vascular tone regulation .

  • Interplay with other signaling systems: A3AR interacts with cyclooxygenase (COX) and NADPH oxidase pathways, which are particularly relevant in diabetic cardiovascular complications .

When designing experiments to investigate these mechanisms, researchers should employ multiple complementary approaches including pharmacological interventions, genetic models, and pathway-specific inhibitors to establish causality rather than mere correlation.

What are the optimal methods for recombinant expression and purification of mouse A3AR?

Optimal recombinant expression and purification of mouse A3AR requires addressing several technical challenges:

  • Expression system selection:

    • HEK293 cells are commonly used for adenosine receptor expression but naturally express A1AR, A2AAR, and A2BAR, necessitating careful control experiments

    • Insect cell systems (Sf9, Hi5) can provide higher yields but may have different post-translational modifications

    • Yeast systems offer cost-effective production but often require extensive optimization

  • Construct design considerations:

    • Include affinity tags (His, FLAG) for purification while ensuring they don't interfere with receptor function

    • Consider adding thermostabilizing mutations for structural studies

    • For cryogenic electron microscopy studies, fusion partners may be necessary to increase protein size and provide recognition features

  • Solubilization and purification:

    • Detergent selection is critical; mild detergents like DDM or LMNG are often preferred

    • Inclusion of cholesterol or other lipids helps maintain receptor stability

    • Step-wise purification using orthogonal methods (affinity, size exclusion) improves purity

  • Functional validation:

    • Verify ligand binding using radioligand competition assays

    • Assess G protein coupling using reconstitution systems

    • NanoBiT association assays can determine receptor-ligand interactions with high sensitivity

How can structural insights from human A3AR studies be applied to mouse A3AR research?

Recent cryo-EM structures of human A3AR provide valuable insights that can be translated to mouse A3AR research with appropriate considerations:

  • Conserved binding pocket elements: The orthosteric binding pocket of A3AR shows conserved elements across species. Key residues like His3.37, Ser5.42, and Ser6.52 form a unique sub-pocket critical for selective agonist binding . When designing ligands for mouse studies, focus on conserved interactions while accounting for species-specific differences.

  • Extracellular loop 3 (ECL3) significance: ECL3 plays a crucial role in ligand selectivity and receptor activation . Comparative analysis of human and mouse ECL3 sequences can help predict ligand specificity differences and inform experimental design when testing compounds across species.

  • Activation mechanisms: The A3AR activation mechanism involves conserved motifs including the W6.48 "toggle switch" and propagation through P5.50I3.40F6.44, D3.49R3.50Y3.51, and N7.49P7.50xxY7.53 motifs . These mechanisms likely function similarly in mouse A3AR and can guide the design of activation-state specific tools.

  • Chimeric receptor approach: The successful generation of chimeric receptors with ECL3 from A3AR grafted onto other adenosine receptor subtypes demonstrates a powerful approach for investigating structure-function relationships . Similar chimeric strategies between human and mouse receptors could help isolate species-specific determinants of pharmacology.

What functional assays are most appropriate for characterizing mouse A3AR activity?

The selection of functional assays for mouse A3AR characterization depends on the specific research questions:

  • G protein coupling assays:

    • NanoBiT association assays provide high sensitivity for measuring ligand-induced conformational changes

    • GTPγS binding assays directly measure G protein activation

    • BRET/FRET-based assays allow real-time monitoring of receptor-G protein interactions

  • Downstream signaling measurements:

    • cAMP inhibition assays are fundamental for A3AR function as it couples to Gi proteins

    • Calcium mobilization assays detect signaling through Gq/11 or Gβγ-mediated pathways

    • ERK phosphorylation assays capture both G protein and β-arrestin pathways

  • Tissue-specific functional readouts:

    • Langendorff perfused heart preparations measure functional recovery following ischemia-reperfusion

    • Coronary artery occlusion models assess infarct size and myocardial salvage

    • Mast cell degranulation assays capture inflammatory aspects of A3AR function

When selecting assays, consider factors like receptor expression levels, presence of other adenosine receptor subtypes, and the signaling pathway of interest. Multiple complementary assays provide more robust characterization than reliance on a single measurement.

How do I reconcile contradictory findings between pharmacological and genetic approaches to mouse A3AR modulation?

Contradictory findings between pharmacological and genetic approaches to A3AR modulation are common and require systematic analysis:

  • Pharmacological limitations:

    • Ligand selectivity issues: Many compounds show overlapping activity at different adenosine receptor subtypes

    • Concentration-dependent effects: A3AR ligands may act on multiple targets at higher concentrations

    • Off-target effects: Some effects may be receptor-independent

  • Genetic model considerations:

    • Developmental compensation: Knockout models may develop compensatory mechanisms

    • Background strain effects: Different mouse strains show variable responses

    • Conditional vs. constitutive deletion: Timing and tissue specificity of deletion impacts outcomes

  • Methodological approaches to reconcile contradictions:

    • Use multiple pharmacological tools with different chemical scaffolds

    • Combine partial genetic knockdown (siRNA) with pharmacological approaches

    • Employ conditional knockout models with temporal control

    • Cross-validate findings using both gain-of-function and loss-of-function approaches

For example, the contradictory findings that A3AR knockout mice show improved cardiac recovery after ischemia while A3AR agonists can be cardioprotective might be reconciled by considering timing-dependent effects or the involvement of different cellular pathways.

What are the key considerations for translating mouse A3AR findings to human applications?

Translating mouse A3AR research to human applications requires careful attention to several factors:

  • Species differences in receptor pharmacology:

    • Significant sequence differences between human and rodent A3AR result in different ligand binding profiles

    • Human-selective compounds often show reduced potency at mouse A3AR

    • Design studies that account for these differences using species-appropriate compounds

  • Experimental design for translational validity:

    • Use multiple animal models and cell types

    • Include human tissues or humanized mouse models when possible

    • Establish clear correlation between receptor occupancy and functional effects

  • Disease context relevance:

    • Mouse models may not fully recapitulate human disease pathophysiology

    • Age-dependent changes in A3AR expression differ between species

    • Consider comorbidities that are common in human patients but absent in mouse models

  • Dosing and pharmacokinetic considerations:

    • Account for species differences in drug metabolism

    • Adjust dosing based on receptor expression levels and binding affinities

    • Consider route of administration and tissue distribution when designing preclinical studies

Successful translation requires integrated approaches that bridge the gap between basic mouse studies and human applications through careful experimental design and awareness of species-specific limitations.

How is recombinant mouse A3AR being used to study cardiovascular disease mechanisms?

Recombinant mouse A3AR is serving as a valuable tool for investigating cardiovascular disease mechanisms through several approaches:

  • Targeted gene deletion studies have revealed that A3AR knockout mice show significantly improved recovery of developed pressure (80±3% vs. 51±3%) following ischemia-reperfusion injury . This surprising finding challenges previous assumptions about A3AR's protective role and suggests context-dependent functions.

  • Pharmacological studies using selective A3AR modulators in wild-type and knockout mice help distinguish direct receptor-mediated effects from compensatory mechanisms. For example, the adenosine receptor antagonist BW-A1433 decreases functional recovery in A3AR knockout but not wild-type hearts, indicating complex interactions between adenosine receptor subtypes .

  • Studies of mPTP regulation through A3AR-mediated signaling provide mechanistic insights into cell survival pathways. The PI3K/Akt pathway activation and subsequent inhibition of glycogen synthase kinase represent key molecular mechanisms underlying A3AR effects .

  • Investigation of age-dependent changes in A3AR expression complements studies showing altered A3AR and A2BAR mRNA levels with aging, similar to changes during ischemia in young hearts . These findings help explain age-dependent differences in response to ischemic injury.

  • Diabetes research utilizing A3AR as a potential cardioprotectant has identified involvement of cyclooxygenases and NADPH oxidase pathways in mediating protective effects, offering new therapeutic targets for diabetic cardiovascular complications .

What technological advances are enabling new insights into mouse A3AR structure and function?

Recent technological advances are revolutionizing our understanding of A3AR structure and function:

  • Cryo-electron microscopy has enabled high-resolution structural determination of adenosine receptors in complex with ligands and signaling partners. While current structures are of human A3AR , these techniques can be applied to mouse A3AR to understand species-specific structural features.

  • NanoBiT association assays provide highly sensitive methods for measuring receptor-ligand and receptor-effector interactions in live cells. These assays have been crucial in determining the selectivity of compounds like CF101 and CF102 for A3AR versus other adenosine receptor subtypes .

  • Chimeric receptor approaches combining domains from different receptor subtypes or species have proven valuable for identifying structural determinants of ligand selectivity. Studies showing that grafting ECL3 from A3AR onto other adenosine receptors confers binding ability to selective A3AR ligands demonstrate the power of this approach .

  • Advanced mouse genetic models including conditional and inducible knockout systems allow for temporal and tissue-specific manipulation of A3AR expression, helping to distinguish developmental from acute effects.

  • Integrated multi-omics approaches combining proteomics, transcriptomics, and metabolomics provide systems-level insights into A3AR signaling networks across different physiological and pathological contexts.

These technological advances are enabling more precise dissection of A3AR biology and accelerating translation of basic findings into potential therapeutic applications.

How might targeting mouse A3AR influence inflammatory responses in cardiovascular disease?

Emerging research suggests A3AR modulation could significantly impact inflammatory processes in cardiovascular disease:

  • A3AR expression on mast cells influences degranulation and release of vasoactive substances. In A3AR knockout mice, this may result in attenuated release of vasoconstricting substances, potentially contributing to vascular changes .

  • A3AR-mediated effects on neutrophil function appear important for cardioprotection during reperfusion. Studies show that A3AR agonist administration at reperfusion protects isolated hearts by reducing neutrophil activation, suggesting a potential therapeutic approach for acute myocardial infarction .

  • The interplay between A3AR and cyclooxygenase pathways offers additional anti-inflammatory mechanisms that may be especially relevant in diabetic cardiovascular complications .

  • Future research should investigate:

    • Cell type-specific A3AR functions in cardiac inflammation

    • Temporal dynamics of inflammatory responses following A3AR modulation

    • Development of inflammation-targeted A3AR modulators with optimized pharmacokinetic properties

    • Combined approaches targeting multiple inflammatory pathways alongside A3AR

Understanding these inflammatory mechanisms will facilitate development of more targeted therapeutic approaches for cardiovascular diseases with significant inflammatory components.

What are the implications of recent structural insights for designing selective mouse A3AR modulators?

Recent structural studies of A3AR provide crucial insights for designing selective mouse A3AR modulators:

  • The identification of a unique sub-pocket formed by His3.37, Ser5.42, and Ser6.52 residues creates opportunities for designing compounds with enhanced selectivity . For mouse-specific compounds, modifications should account for any species differences in this sub-pocket.

  • Structural analysis revealed that selective A3AR agonists like CF101 and CF102 contain specific modifications to the ribose (5'-N-methylcarboxamide) and adenine (N6-(3-iodobenzyl)) moieties that confer potent binding . These structural features can guide rational design of mouse-selective compounds.

  • The critical role of extracellular loop 3 (ECL3) in determining ligand selectivity suggests that compounds designed to interact with species-specific ECL3 residues might achieve improved selectivity profiles .

  • Understanding the conformational changes associated with receptor activation, including movement of the W6.48 "toggle switch" and rearrangements of conserved motifs , enables design of biased ligands that selectively activate specific downstream pathways.

  • Future compound development should focus on:

    • Optimizing interactions with species-specific residues

    • Developing compounds with distinct signaling bias

    • Creating tool compounds with improved pharmacokinetic properties for in vivo studies

    • Designing fluorescent or radiolabeled probes based on structural insights

These structure-guided approaches promise to yield more selective and effective tools for investigating mouse A3AR biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.