Recombinant Mouse Adiponectin receptor protein 2 (Adipor2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Adipor2; D6Ucla1e; Parq2; Adiponectin receptor protein 2; Progestin and adipoQ receptor family member 2; Progestin and adipoQ receptor family member II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPSLETPVCSSYYENSPE EPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFVGLGLSGIIPTLHYVISE GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF VHFHGVSNLQEFRFMIGGGCTEEDAL
Uniprot No.

Target Background

Function
Adiponectin receptor 2 (AdipoR2) is a receptor for adiponectin, a crucial hormone secreted by adipocytes that plays a vital role in regulating glucose and lipid metabolism. AdipoR2 is essential for maintaining normal body fat and glucose homeostasis. The binding of adiponectin to AdipoR2 activates a signaling cascade that leads to increased PPARα activity, ultimately resulting in enhanced fatty acid oxidation and glucose uptake. AdipoR2 exhibits intermediate affinity for both globular and full-length adiponectin. It is also necessary for proper revascularization following chronic ischemia caused by blood vessel severing.
Gene References Into Functions
  1. These findings suggest that AdipoR1 and AdipoR2 exert overlapping and distinct effects in skeletal muscle, consistent with enhanced adiponectin sensitivity. However, these effects appear insufficient to alleviate established obesity-induced adiponectin resistance. PMID: 28145500
  2. Macrophage polarization is a key factor regulating AdipoR expression and distinct APN-mediated macrophage inflammatory responses. PMID: 25392268
  3. AdipoR1 deficiency, but not AdipoR2 deficiency, leads to diet-induced metabolic dysfunction. This finding reveals that these receptors play highly divergent roles in vascular and metabolic homeostasis. PMID: 24742672
  4. Data indicate that GnRH (gonadotropin-releasing hormone) neurons in the forebrain express AdipoR2 (but not AdipoR1). Adiponectin/AdipoR2 signal transduction via protein kinase C zeta down-regulates neurotransmission in a subpopulation of GnRH neurons. PMID: 24564393
  5. These results demonstrate that increasing adiponectin and/or adipoR2 expression through gene transfer is an effective strategy for managing the obesity epidemic. PMID: 23425917
  6. APN, AdipoR1, and AdipoR2 are present in human and mouse retinas. Additionally, retinal APN and AdipoR1 protein levels are elevated in type 1 diabetes mellitus mice. PMID: 23922494
  7. Our findings show that exercise training performed concurrently with a high-fat diet reduces insulin resistance and improves adipoR1-2/APPL1 protein levels in hepatic, adipose, and skeletal muscle tissue. PMID: 23046739
  8. Human biosynthetic insulin had little or no effect on AdipoR1 expression in 3T3-L1 cells but significantly up-regulated AdipoR2 mRNA levels in a biphasic manner. PMID: 23043361
  9. Gene expression of adiponectin and AdipoR1/AdipoR2 receptors gradually increases during the wound healing process. PMID: 22904306
  10. Tiliroside treatment upregulated the messenger RNA expression levels of hepatic adiponectin receptor (AdipoR)-1 and AdipoR2 and skeletal muscular AdipoR1. PMID: 21889885
  11. This study demonstrates that AdipoR2 is expressed on warm-sensitive neurons of the hypothalamic preoptic area and contributes to the central hyperthermic effects of adiponectin. PMID: 22000082
  12. Adipoq signaling plays a role in preimplantation embryo development and uterine receptivity. PMID: 21106494
  13. Investigation of Adipor2 and Adipor1 expression and localization during embryo development. PMID: 20663797
  14. Adiponectin receptor 2 (AdipoR2) was differentially regulated by alcohol in the anterior cingulate cortex in a K-ras-dependent manner. PMID: 20380822
  15. Data suggest that low adiponectin receptors 1 and 2 in visceral adipocytes and adipose tissue, and further suppression in adipose tissue of insulin-resistant animals, indicate disturbed adiponectin bioactivity. PMID: 20470935
  16. Liver steatosis is associated with downregulation of AdipoR2 and a reduction of AdipoR2 in the liver, along with a reduction of serum adiponectin in the obese C57BL mouse. PMID: 19763702
  17. The expression of AdipoR2 and (primarily) AdipoR1 in the mouse adrenal cortex and the adrenocortical cell line Y-1 was detected. PMID: 19878661
  18. Cloning of cDNAs encoding adiponectin receptors 1 and 2 (AdipoR1 and AdipoR2) by expression cloning [AdipoR1 & AdipoR2]. PMID: 12802337
  19. Growth hormone is a positive regulator of AdipoR2. PMID: 14759511
  20. Adiponectin receptor expression is regulated by insulin and Foxo1. PMID: 15123605
  21. RT-PCR revealed the expression of the adiponectin receptor AdipoR1 mRNA in mouse islets, however, with no difference in the expression level between the two dietary fat feeding groups. PMID: 15358228
  22. A link between adiponectin and bone homeostasis was demonstrated by showing transcription, translation, and secretion of adiponectin, as well as the expression of its receptors, AdipoR1 and AdipoR2, in bone-forming cells. PMID: 15454091
  23. Our results suggest that regulation of AdipoR1, but not that of AdipoR2, may be involved in glucose and lipid metabolism in diabetic states. PMID: 15613685
  24. In conclusion, our findings suggest a fat depot-specific regulation of AdipoR1 and AdipoR2 gene expression in brown and white fat by fasting. PMID: 15752770
  25. AdipoR1 and AdipoR2 exhibit differential but overlapping expression profiles during mouse development. PMID: 15939384
  26. Wy-14,643 treatment upregulated the expression of the adiponectin receptor (AdipoR)-1 and AdipoR2. PMID: 16306350
  27. Reduced circulating adiponectin occurs in rat fatty liver disease but is elevated in mouse cirrhosis, with similar findings observed in humans. Diminished hepatic expression of adiponectin receptors (AdipoR2 and AdipoR1) was only found in liver cirrhosis. PMID: 17006986
  28. A defect in the AdipoR2 gene may represent a mechanism underlying the etiology of certain subgroups of type 2 diabetic patients who eventually develop overt diabetes, while other obese patients do not. PMID: 17068142
  29. Advanced age and high-fat feeding, both of which are factors that predispose humans to obesity and insulin resistance, are associated with decreasing adiponectin and increasing AdipoR1 and/or AdipoR2 levels. PMID: 17164441
  30. Adipo1 and 2 serve as the predominant receptors for adiponectin in vivo and play essential roles in the regulation of glucose and lipid metabolism, inflammation, and oxidative stress in vivo. PMID: 17268472
  31. The physiological significance of Adipor1 and Adipor2 in glucose and lipid metabolism and the risk for obesity, type 2 diabetes, and cardiovascular disease is reported. PMID: 17327425
  32. Acute exercise affects the expression level of adiponectin receptors. An increase in Foxo1 expression might be related to the regulation of adiponectin receptors. PMID: 17647137
  33. Physical training for 4 weeks resulted in increased AdipoR1 and AdipoR2 mRNA expression in subcutaneous fat, which may improve insulin resistance. PMID: 17878241
  34. Adiponectin receptor 1 and 2 (AdipoR1 and R2) mRNA levels in the liver and skeletal muscle were normal, but hepatic insulin receptor mRNA was increased in growth hormone/lactogen-mutant mice. PMID: 17975745
  35. AdipoR2 mRNA levels are decreased in diet-induced diabetic mice. PMID: 18222103
  36. Adiponectin resistance and sensitivity mediated by AdipoR2 in hepatocytes regulated steatohepatitis progression by changing PPAR-alpha activity and reactive oxygen species accumulation. AdipoR2 is a promising target for treating fatty liver. PMID: 18666257
  37. Adiponectin (APN) induces IL-6 production mediated by APN receptor 1, not APN receptor 2, in adult mouse cardiac fibroblasts. This induction leads to the stimulation of the gp130/Janus kinase signaling pathway, resulting in STAT3 activation. PMID: 18795895
  38. Adipor1 and Adipor2 were present in proopiomelanocortin and neuropeptide Y neurons in the arcuate nucleus. PMID: 18971219
  39. Gene expression of AdipoR2 is significantly lower in the liver of ob obese mice. PMID: 19062045
  40. Results suggest that AdiR2 expression is regulated by palmitate via PPAR-alpha. PMID: 19336949
  41. Results characterize the expression and interaction of adiponectin receptors 1 and 2 and adiponectin, respectively, in regulating the activity of growth hormone-secreting cells. PMID: 19500219

Show More

Hide All

Database Links
Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in liver and quadriceps muscle (at protein level). Highly expressed in liver. Highly expressed in white adipose tissue, and at intermediate levels in brown adipose tissue. Expressed at intermediate level in heart, kidney, lung and skeletal muscle

Q&A

What is the basic structure of AdipoR2 and how does it differ from typical membrane receptors?

AdipoR2 is a 386-amino acid protein containing seven transmembrane domains. Unlike typical G protein-coupled receptors (GPCRs), AdipoR2 has an inverted membrane topology with the N-terminus facing the cytoplasm and the C-terminus oriented extracellularly . This unique orientation is functionally significant, as it affects how AdipoR2 interacts with intracellular signaling molecules rather than G proteins. The protein has a molecular weight of approximately 44 kDa and functions as a receptor for full-length adiponectin, mediating its metabolic effects primarily in the liver.

What are the key differences between AdipoR1 and AdipoR2?

Despite structural similarities, AdipoR1 and AdipoR2 have distinct tissue distribution patterns and downstream signaling pathways:

CharacteristicAdipoR1AdipoR2
Predominant expressionSkeletal muscleLiver
Ligand preferenceHigher affinity for globular adiponectinHigher affinity for full-length adiponectin
Primary signaling pathwayAMPK pathwayPPAR-α pathway
Main metabolic effectGlucose metabolismFatty acid oxidation
Knockout phenotypeGlucose intoleranceReduced high-fat diet-induced insulin resistance but potential deterioration of glucose homeostasis

These differences highlight the complementary roles these receptors play in mediating adiponectin's metabolic effects across different tissues .

What expression systems are most effective for producing functional recombinant mouse AdipoR2?

Multiple expression systems can be used to produce recombinant mouse AdipoR2, each with distinct advantages:

  • E. coli expression: Provides high yield but often results in inclusion bodies requiring refolding. This system has been successfully used to produce full-length mouse AdipoR2 (1-386aa) with N-terminal His tags .

  • Mammalian cell expression (HEK-293): Offers proper protein folding and post-translational modifications, resulting in higher-quality protein with improved functionality. HEK-293 cells are particularly valuable for expressing full-length AdipoR2 protein with native conformation .

  • Insect cell expression: Provides a balance between yield and proper folding for membrane proteins.

For functional studies requiring properly folded protein, mammalian expression systems are generally preferred despite lower yields, as they maintain the native structure necessary for ligand binding studies .

What methods can be used to verify recombinant AdipoR2 functionality?

Several biophysical and biochemical approaches can verify the functionality of recombinant AdipoR2:

  • Ligand binding assays:

    • Surface Plasmon Resonance (SPR): SPR analysis of ADIPOR2 interaction with compounds like SCM-198 can determine binding affinity (Kd ≈ 1.99 μM) .

    • Microscale Thermophoresis (MST): Provides binding affinity measurements in solution (Kd ≈ 2.308 μM for AdipoR2-SCM-198 interaction) .

  • Thermal stability assessment:

    • Differential Scanning Fluorimetry (DSF): Measures thermal transition midpoints (Tm) of recombinant AdipoR2 in the presence/absence of ligands. Functional AdipoR2 shows a shift in Tm from 62.8°C to 68.6°C when bound to ligands like SCM-198 .

  • Pull-down assays:

    • Biotinylated ligands can be used to affinity-purify functional AdipoR2 from either recombinant preparations or tissue extracts .

  • Downstream signaling activation:

    • Measuring PPAR-α activation or fatty acid oxidation in cells expressing recombinant AdipoR2 after stimulation with adiponectin.

These complementary approaches ensure that recombinant AdipoR2 maintains not only its structural integrity but also its functional capacity to bind ligands and initiate downstream signaling.

How does AdipoR2 deficiency impact metabolic phenotypes in mouse models?

AdipoR2 deficiency in mouse models reveals complex metabolic phenotypes with important implications for metabolic disease research:

  • Improved insulin sensitivity initially: AdipoR2 knockout mice show reduced high-fat diet-induced insulin resistance, suggesting a protective effect against certain aspects of metabolic syndrome .

  • Reduced dyslipidemia: AdipoR2 deletion diminishes high-fat diet-induced dyslipidemia .

  • Paradoxical glucose homeostasis deterioration: Despite initial improvements in insulin sensitivity, prolonged high-fat feeding in AdipoR2-deficient mice leads to deterioration of glucose homeostasis due to failure of pancreatic β-cells to adequately compensate for the moderate insulin resistance .

  • Altered membrane phospholipid composition: AdipoR2 knockdown increases the rigidifying effect of palmitic acid on cell membranes and causes an excess of saturated fatty acids among phosphatidylcholines (PCs) and phosphatidylethanolamines (PEs) .

These findings suggest that AdipoR2 defects may represent a mechanism underlying the etiology of certain subgroups of type 2 diabetic patients who eventually develop overt diabetes despite initial metabolic advantages .

What molecular mechanisms explain AdipoR2's role in membrane lipid homeostasis?

AdipoR2 plays a critical role in membrane lipid homeostasis through several mechanisms:

  • Prevention of palmitic acid-induced membrane rigidification: FRAP (Fluorescence Recovery After Photobleaching) analysis demonstrates that AdipoR2 knockdown greatly increases the rigidifying effect of palmitic acid (PA) on cell membranes. When AdipoR2 is knocked down in HEK293 cells treated with PA, membrane fluidity is significantly reduced .

  • Regulation of membrane phospholipid composition: Lipidomics analysis reveals that AdipoR2 knockdown causes:

    • Dramatic increase in saturated fatty acids (SFAs) among phosphatidylcholines (PCs)

    • Higher levels of SFAs in phosphatidylethanolamines (PEs)

    • Increased saturated fatty acid content in triacylglycerols (TAGs)

  • Morphological cellular changes: HEK293 cells with AdipoR2 knockdown display altered morphology when exposed to palmitic acid, including the appearance of numerous circular structures in BODIPY-labeled cells .

These findings suggest that AdipoR2 functions as a protective factor against palmitic acid-induced membrane rigidification, which may contribute to its role in maintaining insulin sensitivity and proper cellular function.

How does adiponectin regulate its own receptor expression?

Adiponectin regulates its own receptor expression through a sophisticated feedback mechanism:

  • Negative feedback on AdipoR2: Transgenic mice with moderate expression of exogenous adiponectin targeted to adipose tissue show a reduction in AdipoR2 mRNA levels and protein content in fat depots, along with decreased circulating adiponectin in adult mice .

  • Cell culture confirmation: Recombinant adiponectin added to 3T3-F442A adipocytes causes a decrease in AdipoR2 mRNA levels but does not affect AdipoR1 expression .

  • Inverse regulation: In contrast, AdipoR2 (but not AdipoR1) is specifically upregulated in fat tissue of adiponectin knockout mice (ApN-/-) .

This regulatory feedback loop demonstrates how adiponectin downregulates its own production and the expression of AdipoR2, potentially as a homeostatic mechanism to prevent excessive signaling. The feedback affects multiple metabolic regulators, as reduced AdipoR2 expression in fat tissue is associated with diminished expression of uncoupling protein 2 (involved in energy dissipation) and higher expression of fatty acid synthase and TNFα .

What specific binding sites on AdipoR2 are critical for ligand interactions?

Recent research has identified specific binding sites on AdipoR2 that mediate its interaction with ligands:

  • R335 residue: Molecular dynamics simulations and experimental studies have identified R335 as a critical binding residue in AdipoR2. This residue forms guanidinium pairing with compounds like SCM-198, contributing significantly to binding affinity .

  • R335A mutation effects: SPR binding studies show that the R335A mutation in AdipoR2 significantly reduces binding affinity for ligands like SCM-198, confirming the importance of this residue for ligand interactions .

  • Transmembrane pocket: The seven transmembrane domains of AdipoR2 form a barrel-like structure that creates a hydrophobic pocket, which accommodates ligands and contributes to AdipoR2's function in lipid metabolism.

These structural insights are valuable for developing selective AdipoR2 modulators with therapeutic potential and understanding how different ligands might activate distinct signaling pathways downstream of the receptor.

How can recombinant AdipoR2 be used to screen for novel therapeutic compounds?

Recombinant AdipoR2 protein provides an invaluable tool for screening and developing novel therapeutic compounds:

  • Binding assays:

    • Surface Plasmon Resonance (SPR) allows real-time monitoring of binding kinetics between AdipoR2 and potential ligands

    • Microscale Thermophoresis (MST) can detect binding interactions in solution

    • Differential Scanning Fluorimetry (DSF) identifies compounds that stabilize AdipoR2 structure

  • Structure-activity relationship studies:

    • Comparing binding affinities of structural analogs (e.g., SCM-198 vs. Sinapine) helps identify critical molecular features for AdipoR2 interaction

    • Mutational analysis of key residues (e.g., R335A) confirms binding determinants

  • Therapeutic applications:

    • Identification of compounds like SCM-198 that selectively target the AdipoR2-CaM-CaMKII-NOS3 signaling axis has led to extended treatment windows for acute liver failure in mice (from 3 to 24 hours)

    • Development of structural analogs with improved pharmacokinetic properties

  • Compound validation pipeline:

    • Initial screening using purified recombinant AdipoR2

    • Secondary validation in cellular models expressing AdipoR2

    • Tertiary testing in animal models of metabolic disease

This pipeline has successfully identified compounds that modulate AdipoR2 signaling with therapeutic potential for metabolic disorders, liver diseases, and other conditions where adiponectin signaling plays a role.

How do polymorphisms in ADIPOR2 relate to adiponectin levels and obesity phenotypes?

Genetic variations in the ADIPOR2 gene have significant associations with adiponectin levels and obesity-related phenotypes:

  • Race-specific associations: Studies examining single nucleotide polymorphisms (SNPs) in ADIPOR2 in relation to serum adiponectin levels and body mass index (BMI) have found different associations between black and white participants, highlighting the importance of including diverse populations in genetic studies .

  • Methodology for association studies:

    • Adiponectin measurement in serum by immunoassay using LINCOplex kit (Luminex® xMAP™ Technology)

    • BMI calculation from height and weight measurements

    • Genotyping of SNPs in ADIPOR2

    • Race-stratified linear regression models adjusted for age and percentage African ancestry

  • Clinical relevance: Polymorphisms in ADIPOR2 may explain part of the variability in adiponectin levels and obesity prevalence between different ethnic groups, providing insights into the genetic basis of metabolic disorders.

Understanding these genetic associations could help identify individuals at higher risk of metabolic diseases and potentially guide personalized prevention or treatment strategies.

What is the prognostic value of ADIPOR2 expression in cancer research?

ADIPOR2 expression has emerging value as a prognostic marker in cancer research:

  • Pan-cancer analysis approaches:

    • Univariate Cox analysis using data from TCGA, GETx, CCLE, and PCAWG databases

    • Survival Map modules and Kaplan-Meier plots to evaluate the relationship between ADIPOR2 expression and patient outcomes

  • Distinct roles from ADIPOR1:

    • Despite their functional similarities in metabolic regulation, ADIPOR1 and ADIPOR2 show distinct prognostic patterns across different cancer types

    • These differences suggest tissue-specific functions that may be relevant to cancer progression

  • Potential mechanisms:

    • ADIPOR2's role in regulating fatty acid oxidation and membrane lipid composition may affect cancer cell metabolism

    • Adiponectin signaling through ADIPOR2 may influence inflammatory pathways relevant to tumor microenvironment

This research direction highlights the expanding significance of adiponectin receptors beyond metabolic disorders into cancer biology, suggesting potential for ADIPOR2-targeted therapies or its use as a biomarker in specific cancer contexts.

What are the latest antibody-based methods for detecting and quantifying AdipoR2?

Several advanced antibody-based methods are available for detecting and quantifying AdipoR2 in research settings:

  • Western blot analysis:

    • Rabbit polyclonal antibodies against AdipoR2 can detect the protein in various tissues including human placenta, rat liver, and cell lines such as HeLa and A549

    • The observed molecular weight is typically 40-45 kDa

    • Recommended antibody dilutions range from 1:500 to 1:2000

  • Immunohistochemistry (IHC):

    • Paraffin-embedded tissues can be stained for AdipoR2 using specific antibodies

    • AdipoR2 expression has been detected in multiple rat tissues including liver, testis, skeletal muscle, heart, kidney, and stomach

    • Typical working concentrations for IHC are around 20 μg/ml followed by DAB staining

  • Immunoprecipitation:

    • AdipoR2 can be immunoprecipitated from tissue lysates using 0.5-4.0 μg of antibody for 1.0-3.0 mg of total protein

    • This technique is valuable for studying protein-protein interactions involving AdipoR2

  • Immunofluorescence:

    • Allows visualization of AdipoR2 cellular localization

    • Particularly useful for studying membrane distribution and internalization dynamics

These methods provide complementary approaches for studying AdipoR2 expression, localization, and interactions in both basic research and disease-focused investigations.

How can advanced lipidomics approaches enhance our understanding of AdipoR2 function?

Advanced lipidomics approaches have revealed critical insights into AdipoR2 function:

  • Comprehensive lipid profiling:

    • Lipidomics analysis of cells with AdipoR2 knockdown reveals dramatic increases in saturated fatty acids among phosphatidylcholines (PCs), phosphatidylethanolamines (PEs), and triacylglycerols (TAGs)

    • These changes are particularly pronounced when cells are exposed to palmitic acid

  • Membrane fluidity assessment:

    • FRAP (Fluorescence Recovery After Photobleaching) analysis complements lipidomics data by demonstrating functional consequences of altered lipid composition

    • AdipoR2 knockdown greatly increases the rigidifying effect of palmitic acid on cell membranes

  • Methodological approaches:

    • Cells are typically cultivated in serum-free media containing different fatty acids (PA, OA, or PA+OA)

    • Lipid extraction followed by mass spectrometry analysis

    • Statistical comparison between siRNA-treated cells and non-target siRNA controls under the same cultivation conditions

  • Functional correlations:

    • Changes in membrane phospholipid composition can be correlated with alterations in insulin signaling

    • Lipidomics data help explain mechanistically how AdipoR2 contributes to insulin sensitivity

These advanced lipidomics approaches provide molecular-level insights into how AdipoR2 regulates membrane lipid composition and cellular responses to fatty acids, contributing significantly to our understanding of its role in metabolic health and disease.

What are promising strategies for developing selective AdipoR2 modulators?

Several promising strategies are emerging for developing selective AdipoR2 modulators:

  • Structure-guided drug design:

    • Targeting specific binding residues like R335 that form guanidinium pairing with ligands

    • Exploiting structural differences between AdipoR1 and AdipoR2 to achieve selectivity

  • Identification of natural compounds:

    • SCM-198, derived from a traditional Chinese medicine herb, selectively targets the AdipoR2-CaM-CaMKII-NOS3 axis

    • Comparing structural analogs (e.g., SCM-198 vs. Sinapine) to identify critical molecular features

  • Peptide-based approaches:

    • Development of peptide fragments derived from adiponectin that selectively activate AdipoR2

    • Engineering peptides to target specific binding domains

  • Biophysical screening methods:

    • Using SPR, MST, and DSF to screen compound libraries for selective AdipoR2 binders

    • SPR and MST have successfully identified compounds with Kd values in the low micromolar range (1.99-2.308 μM)

  • Therapeutic applications:

    • Compounds that extend treatment windows for acute liver failure

    • Modulators that improve metabolic parameters without adversely affecting glucose homeostasis

    • Context-specific activation of AdipoR2 signaling pathways

These approaches hold promise for developing selective AdipoR2 modulators with therapeutic potential for metabolic disorders, liver diseases, and other conditions where adiponectin signaling plays a role.

How might single-cell technologies advance our understanding of AdipoR2 biology?

Single-cell technologies offer unprecedented opportunities to advance AdipoR2 research:

  • Single-cell RNA sequencing (scRNA-seq):

    • Reveals cell-type specific expression patterns of AdipoR2 in heterogeneous tissues like liver

    • Identifies co-expression patterns with other metabolic regulators

    • Detects changes in AdipoR2 expression during disease progression or in response to treatments

  • Single-cell proteomics:

    • Maps AdipoR2 protein levels and post-translational modifications at single-cell resolution

    • Correlates AdipoR2 expression with cell state and metabolic phenotypes

  • Spatial transcriptomics:

    • Preserves spatial context while measuring AdipoR2 expression

    • Particularly valuable for understanding zonation of AdipoR2 expression in liver lobules

  • CRISPR screening at single-cell level:

    • Identifies genes that regulate AdipoR2 expression or function

    • Discovers synthetic lethal interactions with AdipoR2 modulation

  • Live-cell imaging techniques:

    • Tracks AdipoR2 trafficking and dynamics in real-time

    • Visualizes signaling events downstream of AdipoR2 activation

These technologies promise to resolve current contradictions in AdipoR2 biology by accounting for cellular heterogeneity, providing context-specific insights into receptor function, and revealing cell-type specific responses to AdipoR2 modulation that may be obscured in bulk tissue analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.