Recombinant Mouse ADP-ribosylation factor-like protein 6-interacting protein 1 (Arl6ip1)

Shipped with Ice Packs
In Stock

Description

Protein Architecture

Arl6ip1 is a 203-amino acid protein (23.4 kDa) characterized by:

  • Reticulon Homology Domain (RHD): Features short hydrophobic transmembrane hairpins (TM1+2 and TM3+4) that shape high-curvature ER tubules .

  • Ubiquitination Sites: Critical for clustering with FAM134B and facilitating ER-phagy .

  • His-Tagged Recombinant Form: Expressed in E. coli (1–203 aa) and purified for structural and functional studies .

PropertySpecificationSource
Molecular Weight23.4 kDa
Expression SystemE. coli (His-tagged)
Structural MotifsRHD-like transmembrane domains

ER Membrane Shaping

Arl6ip1 stabilizes ER tubules via:

  • Reticulon-like Activity: Induces tubular ER structures and excludes luminal proteins .

  • Interaction with Atlastin: Mediates ER network formation independent of microtubules .

Autophagy Regulation

Arl6ip1 modulates autophagy pathways by:

  • LC3B Binding: Direct interaction with LC3B promotes autophagosome formation .

  • Mitophagy Control: Maintains mitochondrial-ER connectivity (MAMs) and regulates mitophagy via BCL2L13 .

Neuroprotection and Disease Association

  • Hereditary Spastic Paraplegia (HSP): Arl6ip1 knockout mice exhibit axonal demyelination, neuroinflammation, and sensory loss .

  • ER-Phagy Defects: Ubiquitinated Arl6ip1 clusters with FAM134B to degrade ER sheets, preventing neurodegeneration .

ER-Phagy and Neurodegeneration

Arl6ip1 and FAM134B form heteromeric clusters on ER membranes:

  • Ubiquitination-Dependent Clustering: Enhances ER remodeling and ER-phagy flux .

  • HSP Pathogenesis: Arl6ip1 deficiency leads to ER expansion, autophagy dysfunction, and axonal degeneration .

Gene Therapy Applications

  • AAV9-Mediated Delivery: Restores Arl6ip1 expression in HSP mouse models, reducing neuroinflammation and improving gait abnormalities .

  • Mechanistic Rescue: Reestablishes ER-mitochondrial connectivity and autophagy homeostasis .

Antibody-Based Detection

Anti-Arl6ip1 antibodies are used for:

  • Western Blotting: Detects endogenous and recombinant protein .

  • Immunohistochemistry: Localizes Arl6ip1 to ER and MAMs .

Targeted Gene Therapy

  • HSP Treatment: AAV9-ARL6IP1 delivery shows promise in preclinical models, rescuing myelination and motor function .

  • ER-Phagy Modulation: Ubiquitination of Arl6ip1 may serve as a therapeutic target to enhance ER proteostasis .

Research Gaps and Challenges

  • Mechanistic Complexity: Dual roles in ER shaping and autophagy require deeper investigation.

  • Human Translation: Clinical trials are needed to validate preclinical efficacy .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, kindly indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery timeframes, please consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Arl6ip1; Arl6ip; ADP-ribosylation factor-like protein 6-interacting protein 1; ARL-6-interacting protein 1; Aip-1; Protein TBX2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Arl6ip1
Target Protein Sequence
MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFSLKEEKPKMYFMTMIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGII LKYIGMAKREINKLLKQKEKKNE
Uniprot No.

Target Background

Function
Arl6ip1 positively regulates SLC1A1/EAAC1-mediated glutamate transport by increasing its affinity for glutamate in a PKC activity-dependent manner. It promotes the catalytic efficiency of SLC1A1/EAAC1, likely by reducing its interaction with ARL6IP5, a negative regulator of SLC1A1/EAAC1-mediated glutamate transport. Arl6ip1 plays a role in the formation and stabilization of endoplasmic reticulum tubules. It negatively regulates apoptosis, potentially by modulating the activity of caspase-9 (CASP9). Arl6ip1 inhibits the cleavage of CASP9-dependent substrates and downstream apoptosis markers, but not CASP9 itself. It may be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.
Database Links
Protein Families
ARL6ip family
Subcellular Location
Endomembrane system; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Tissue Specificity
Expressed in the cerebral cortex, cerebellum, hippocampus, olfactory bulbs, medulla oblongate and limbic system (at protein level). Ubiquitous. Expressed in all hematopoietic cell lineages, with highest levels in early myeloid progenitor cells.

Q&A

What is the structural organization of mouse Arl6ip1?

Arl6ip1 is characterized by reticulon-homology domain (RHD)-like structural elements. The protein contains two membrane-embedded helical hairpins (TM1+2 and TM3+4) separated by an accessible linker segment, with both the N-terminus and C-terminus facing the cytoplasm. Structural models produced using AlphaFold reveal that Arl6ip1 contains two membrane-embedded helical hairpins with two amphipathic helices . This structure allows Arl6ip1 to bind to liposomes in vitro and increase the proportion of smaller liposomes, a property similar to FAM134B .

What are the primary cellular functions of Arl6ip1?

Arl6ip1 primarily functions in ER membrane shaping and organization. It localizes predominantly to the ER membrane and plays critical roles in:

  • Maintaining ER-mitochondrial homeostasis through interactions at mitochondria-associated membranes (MAMs)

  • Regulating autophagy through direct interaction with LC3B and BCl2L13

  • Supporting neuronal differentiation and preventing cell death during neural development

  • Modulating mitochondrial function and preventing oxidative stress-induced apoptosis

How does Arl6ip1 interact with other ER-shaping proteins?

Arl6ip1 forms both homodimers and heterodimers with other ER-shaping proteins. Mass spectrometry analysis has revealed that approximately 7% of proteins exclusively interact with Arl6ip1 homodimers, while about 40% interact with both Arl6ip1 and FAM134B . Key interaction partners include FAM134B, FAM134C, and reticulon proteins (RTN1, RTN3, and RTN4) . These interactions likely contribute to the coordination of ER structure and function, particularly in specialized cellular contexts like neurons.

How can Arl6ip1 knockout mouse models be generated and validated?

Arl6ip1 knockout (KO) mouse models can be generated to represent clinically relevant frameshift mutations that mimic hereditary spastic paraplegia (HSP) phenotypes. Validation should include:

  • PCR-based genotyping using appropriate primers targeting the deleted region

  • Quantitative real-time PCR (qRT-PCR) to confirm reduction of mRNA levels in target tissues

  • Western blot analysis to verify protein absence in relevant tissues

  • Phenotypic assessment including gait analysis, hindlimb reflexes, and motor function tests

For example, researchers have confirmed successful Arl6ip1 knockout by qPCR of RNA isolated from mouse embryonic fibroblasts and immunoblot analyses of tissue lysates .

What are the optimal methods for visualizing Arl6ip1 localization in cells?

For accurate visualization of Arl6ip1 subcellular localization:

  • Immunofluorescence using antibodies directed against the cytoplasmic loop of Arl6ip1

  • Fluorescence protease protection assays to confirm topology

  • Co-localization studies with ER markers (such as calnexin) and mitochondrial markers (such as VDAC1)

  • Use of tagged constructs (e.g., Venus V2-ARL6IP1) for live-cell imaging of heterodimer distribution along the ER

Research has demonstrated that Arl6ip1 primarily localizes to the ER membrane and can be found at ER-mitochondria contact sites .

What phenotypic assessments are most informative when studying Arl6ip1-deficient models?

Key phenotypic assessments for Arl6ip1-deficient models include:

  • Neurological assessment:

    • Measurement of foot-base angle to evaluate gait disorders

    • Hindlimb reflex testing

    • Footprint analysis for locomotor function

  • Cellular pathology evaluation:

    • Neuronal cell counts and neurite outgrowth quantification

    • Measurement of MAP2 expression for neuronal differentiation

    • Assessment of myelination through transmission electron microscopy

  • Inflammatory markers:

    • mRNA expression analysis of M1 microglia markers (Cxcr3-1, Cd40, Cd80)

    • mRNA expression analysis of M2 microglia markers (Arg-1, Cd163, Igf-1)

    • Quantification of proinflammatory cytokines and chemokines

  • Axonal degeneration markers:

    • Neurofilament light chain (NF-L) concentrations in CSF and serum

How does Arl6ip1 deficiency contribute to neurodegeneration?

Arl6ip1 deficiency contributes to neurodegeneration through multiple mechanisms:

  • Disrupted ER-mitochondrial homeostasis: Loss of Arl6ip1 impairs the interaction between ER and mitochondria at MAMs, leading to mitochondrial dysfunction .

  • Dysregulated autophagy: Arl6ip1 directly interacts with autophagy proteins LC3B and BCl2L13. When Arl6ip1 is depleted, autophagy processes are altered, affecting the clearance of damaged mitochondria .

  • Neuroinflammation: In vivo brain histopathological analysis of Arl6ip1 KO mice reveals significant neuroinflammation in white matter, including the corticospinal tract .

  • Demyelination: Arl6ip1 KO mice exhibit axonal demyelination, with TEM analysis showing fewer and more thinly myelinated nerve fibers in the spinal cord .

  • Increased apoptosis: Silencing of Arl6ip1 increases oxidative stress-induced apoptosis, with the total apoptotic cell population rising from 3.4% to 41.85% in standard conditions and from 8.9% to 53.4% under neuronal differentiation conditions .

What is the relationship between Arl6ip1 and hereditary spastic paraplegia (HSP)?

Arl6ip1 mutations have been associated with hereditary spastic paraplegia. Key findings include:

  • Clinical presentation: Arl6ip1 knockout mice mimic HSP phenotypes with severe spastic paralysis and gait abnormalities .

  • Pathological changes: These include demyelination of axons and neuroinflammation in white matter regions, particularly the corticospinal tract .

  • Molecular mechanism: The c.577-580delAAAC variant in Arl6ip1 represents a knockout allele leading to nonsense-mediated decay, with no variant protein detected in patient fibroblasts .

  • Therapeutic potential: AAV9-ARL6IP1 gene delivery has been shown to reduce limb paraplegia and gait abnormality in mouse models, suggesting Arl6ip1 as a potential target for HSP gene therapy .

How can protein-protein interactions of Arl6ip1 be effectively studied?

To study Arl6ip1 protein-protein interactions:

  • Immunoprecipitation followed by LC-MS: This approach has successfully identified interaction partners of Arl6ip1 homodimers and heterodimers with FAM134B .

  • Bimolecular fluorescence complementation (BiFC): Using split Venus fusion proteins (Venus V1-FAM134B and Venus V2-ARL6IP1) to visualize heterodimer distribution along the ER .

  • Domain deletion analysis: Creating variants lacking specific transmembrane domains (e.g., TM1 and TM2) to identify regions required for protein interactions. For example, Arl6ip1 variants lacking TM1 and TM2 fail to co-precipitate with FAM134B .

  • In vitro binding assays: Using purified proteins to assess direct interactions, such as testing Arl6ip1 binding to LC3 family proteins .

What are the challenges in studying the role of Arl6ip1 in ER-mitochondrial crosstalk?

Studying Arl6ip1 in ER-mitochondrial crosstalk presents several challenges:

  • Complex protein networks: Arl6ip1 operates within a complex network of ER-shaping proteins and mitochondrial factors, making it difficult to isolate its specific contribution.

  • Dynamic organelle interactions: ER-mitochondria contacts are highly dynamic, requiring advanced live-cell imaging techniques to capture functional changes.

  • Tissue-specific effects: Arl6ip1 functions may vary across different tissues and cell types, necessitating multiple model systems.

  • Functional redundancy: Other proteins may compensate for Arl6ip1 deficiency, masking phenotypes in some experimental settings.

  • Integration with autophagy pathways: While Arl6ip1 interacts with autophagy machinery components like LC3B and BCl2L13, it may be indirectly linked to autophagy through proteins like FAM134B, complicating mechanistic studies .

How can gene therapy approaches targeting Arl6ip1 be optimized for neurological disorders?

Optimizing Arl6ip1 gene therapy requires:

  • Vector selection: AAV9 vectors have shown promise for ARL6IP1 delivery in reducing HSP phenotypes and restoring pathophysiological changes in Arl6ip1 KO models .

  • Temporal considerations: Determining the optimal timing for intervention based on disease progression. Early intervention may prevent neurodegeneration before significant pathology develops.

  • Delivery route optimization: Comparing intrathecal, intravenous, and direct CNS delivery methods for maximal efficacy.

  • Dose-response studies: Establishing the minimal effective dose to achieve therapeutic outcomes while minimizing potential side effects.

  • Outcome measures: Developing sensitive metrics to assess efficacy, including:

    • Reduction in neuroinflammatory markers

    • Improvements in myelination

    • Enhanced mitochondrial function

    • Reduced apoptosis in neural tissues

    • Improvements in behavioral and motor function tests

What are the critical controls needed when studying Arl6ip1 knockout models?

Critical controls for Arl6ip1 knockout studies include:

  • Tissue-specific expression analysis: Confirming the degree of Arl6ip1 deletion across different tissues using qRT-PCR and Western blot analysis. For example, research has shown successful disruption of Arl6ip1 in brown adipose tissue with a statistically significant reduction of mRNA levels by 59.4 ± 12.6% (P = 0.013) .

  • Phenotypic comparisons with other ER protein knockouts: Comparing phenotypes with those of knockouts of functionally related proteins (e.g., FAM134B or reticulon proteins).

  • Rescue experiments: Reintroducing wild-type Arl6ip1 to confirm phenotype reversal and establish causality.

  • Assessment of compensatory mechanisms: Measuring expression changes in related proteins that might compensate for Arl6ip1 loss.

  • Background strain controls: Using appropriate background-matched controls to account for strain-specific differences in phenotype.

How should researchers approach conflicting data on Arl6ip1 function in different tissues?

When faced with conflicting data on Arl6ip1 function across tissues:

  • Tissue-specific expression profiling: Quantify baseline Arl6ip1 expression levels across tissues to identify potential differences in functional importance.

  • Context-dependent interaction studies: Investigate whether Arl6ip1 interacts with different partners in different cellular contexts, potentially explaining tissue-specific functions.

  • Conditional knockout models: Develop tissue-specific and inducible knockout models to isolate the role of Arl6ip1 in specific contexts without developmental compensation.

  • Multi-omics approaches: Combine transcriptomics, proteomics, and metabolomics to build comprehensive tissue-specific networks of Arl6ip1 function.

  • Careful experimental design: Ensure that experimental conditions (e.g., age of animals, cell culture conditions) are consistent across studies to minimize artifactual differences.

What are promising areas for future Arl6ip1 research beyond neurological disorders?

Promising research areas for Arl6ip1 beyond neurological disorders include:

  • Adipose tissue metabolism: Arl6ip1 has been shown to be expressed in adipose tissue, and its role in lipid metabolism warrants further investigation. This builds on findings related to ARFRP1 in lipid droplet formation .

  • Mitochondrial quality control: Given its role in ER-mitochondria interactions, Arl6ip1 may be important in cellular energy homeostasis and mitochondrial quality control across multiple tissues.

  • Cellular stress responses: Exploring how Arl6ip1 contributes to cellular adaptation to various stressors, including oxidative stress, ER stress, and metabolic stress.

  • Development and differentiation: Investigating the role of Arl6ip1 in embryonic development and cellular differentiation processes beyond the nervous system.

  • Immune system function: Given its impact on inflammatory processes in neurological contexts, Arl6ip1 may play broader roles in immune regulation.

How might emerging technologies advance our understanding of Arl6ip1 biology?

Emerging technologies that could advance Arl6ip1 research include:

  • Cryo-electron microscopy: To determine the precise structure of Arl6ip1 in membrane environments and in complex with interaction partners.

  • Proximity labeling techniques: BioID or APEX2-based approaches to map the dynamic interactome of Arl6ip1 in living cells.

  • Super-resolution microscopy: To visualize Arl6ip1-mediated ER-mitochondria contacts with nanometer precision.

  • Single-cell multi-omics: To uncover cell type-specific functions and expression patterns of Arl6ip1.

  • CRISPR-based screening: To identify genetic modifiers of Arl6ip1 function and potential compensatory mechanisms.

  • Organoid models: To study Arl6ip1 function in more physiologically relevant 3D tissue contexts, particularly for neurological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.