Recombinant Mouse ADP-ribosylation factor-like protein 6-interacting protein 6 (Arl6ip6)

Shipped with Ice Packs
In Stock

Description

Introduction

ADP-ribosylation factor-like protein 6-interacting protein 6 (Arl6ip6) is a protein that interacts with ARF-like GTPase 6 . Arl6ip6 is also known as ARF like GTPase 6 interacting protein 6 [Homo sapiens (human)] .

Gene Information

The ARL6IP6 gene, also known as ARF Like GTPase 6 Interacting Protein 6, is found in humans . The updated date for this gene is February 9, 2025 .

Expression Analysis

ARL-6 expression is correlated with the activities of tumor-infiltrating immune cells .

ARL-6 and Immune Cell Infiltration in HCC

  • ALR6 expression is associated with the infiltration of dendritic cells, neutrophils, macrophages, CD4+ T cells, CD8+ T cells, and B cells .

  • B cells, CD8+T cells, CD4+T cells, neutrophils, macrophages, and myeloid dendritic cells were significantly correlated with ARL-6 expression in HCC .

Genetic Interactions

GeneMANIA analysis has revealed that ARL6IP6 is one of 20 genes functionally associated with ARL-6 in HCC . Other genes include ATL2, ARL6IP1, ARL6IP4, BBIP1, ARL6IP5, UNC50, CEP19, KIAA0895, ATXN10, IQCB1, CADPS2, and PLEKHA3 .

Recombinant Mouse Arl6ip6 Availability

Recombinant Mouse ADP-ribosylation factor-like protein 6-interacting protein 6 (Arl6ip6) is available for purchase and is produced in Yeast . Other sources include E.coli, Baculovirus and Mammalian cell .

Table 1: Recombinant Mouse Arl6ip6 Products

CodeSourceConjugate
CSB-YP805886MO1YeastN/A
CSB-EP805886MO1E. coliN/A
CSB-EP805886MO1-BE. coliAvi-tag Biotinylated E. coli biotin ligase (BirA). BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
CSB-BP805886MO1BaculovirusN/A
CSB-MP805886MO1Mammalian cellN/A

Related Resources

  • KEGG: mmu:65103

  • STRING: 10090.ENSMUSP00000028336

  • UniGene: Mm.37623

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Arl6ip6; ADP-ribosylation factor-like protein 6-interacting protein 6; ARL-6-interacting protein 6; Aip-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSFVESWRFAGARRRRQVTPGPATRPGYSDYTQGDSWGEGEGDEDEGCDQVARDLRAEFS ARASSETKRAPLLPRVGDGSPVLPDKRNGIFPATAAKRTQARRWPIQALSILCSLLFAVL LAFLLAIAYMIVKELHAENLKNEDDIHTGLLGFWSLLIISLTAGLSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM
Uniprot No.

Target Background

Gene References Into Functions
  1. ADP-ribosylation factor 6 negatively regulates dendritic spine formation. PMID: 16325184
Database Links
Protein Families
ARL6IP6 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is mouse Arl6ip6 and what are its known functions?

Arl6ip6 (ADP ribosylation factor like GTPase 6 interacting protein 6) is a protein that interacts with ADP-ribosylation factor-like proteins. While specific functions of mouse Arl6ip6 aren't extensively documented in current literature, we can infer from human ortholog data that it likely plays roles in membrane protein trafficking and cellular signaling pathways. The mouse Arl6ip6 gene contains 11 exons, similar to the human ortholog which spans 43,361 bases at chromosome location 2q23.3 .

In rats, Arl6ip6 shows predicted functional partnerships with proteins involved in mitochondrial function, RNA splicing regulation, and other cellular processes . Based on its classification as an ARF-like interacting protein, it likely participates in GTP-dependent cell signaling processes involving membrane trafficking or cytoskeletal organization.

  • What techniques are available for detecting mouse Arl6ip6 in experimental samples?

Several methodological approaches can be employed for detecting Arl6ip6:

  • Immunoblotting (Western blot): Using specific antibodies against Arl6ip6, typically with appropriate positive and negative controls to verify specificity

  • Immunofluorescence microscopy: For visualization of subcellular localization, though careful attention to fixation methods is critical as they significantly impact detection patterns

  • RT-PCR and qPCR: For measuring Arl6ip6 mRNA expression levels in different tissues

  • Mass spectrometry: For detection of Arl6ip6 and its potential post-translational modifications

  • Recombinant antibody-like detection: Using engineered ADP-ribose binding domains (ARBDs) fused to immunoglobulin Fc regions, which have been developed for detecting various forms of ADP-ribosylation

Each detection method requires proper validation, including the use of knockout controls or competing peptides to confirm antibody specificity.

  • How is recombinant mouse Arl6ip6 typically produced for research applications?

While the search results don't directly describe production methods for recombinant mouse Arl6ip6, standard recombinant protein production approaches would apply:

  • Expression system selection:

    • Bacterial systems (E. coli): Fast and cost-effective but may lack proper folding and post-translational modifications

    • Insect cells (baculovirus): Better for eukaryotic proteins requiring complex folding

    • Mammalian cells (HEK293, CHO): Optimal for maintaining native structure and modifications

  • Expression vector design:

    • Full-length construct vs. specific domains

    • Selection of appropriate tags (His, GST, FLAG) for purification and detection

    • Consideration of codon optimization for the expression system

  • Purification strategy:

    • Affinity chromatography based on fusion tags

    • Size exclusion chromatography for higher purity

    • Ion exchange chromatography as needed

  • Quality control:

    • SDS-PAGE and Western blot verification

    • Mass spectrometry for identity confirmation

    • Activity assays to confirm functional integrity

For functional studies, researchers should verify that any tags do not interfere with protein activity or interactions.

  • What is known about the conservation of Arl6ip6 across species?

The search results indicate Arl6ip6 is evolutionarily conserved, with orthologs identified across species. The human ARL6IP6 gene is listed in HomoloGene group 11302 , which includes orthologs from multiple species. This conservation suggests fundamental biological importance.

When designing cross-species studies, researchers should consider:

  • Sequence alignment to identify conserved domains and species-specific regions

  • Functional conservation assessment through complementation studies

  • Regulatory element comparison to understand expression pattern differences

While the exact sequence similarity percentages aren't provided in the search results, the inclusion in a shared HomoloGene group indicates significant conservation of structure and potentially function.

  • What experimental controls are essential when studying mouse Arl6ip6?

For rigorous Arl6ip6 research, several controls are critical:

  • Negative controls:

    • Arl6ip6 knockout or knockdown samples

    • Non-specific IgG controls for immunoprecipitation

    • Secondary antibody-only controls for immunofluorescence

  • Positive controls:

    • Overexpression systems with tagged Arl6ip6

    • Tissues known to express high levels of Arl6ip6

    • Recombinant Arl6ip6 protein as a standard

  • Validation controls:

    • Multiple antibodies targeting different epitopes

    • Multiple detection methods for cross-validation

    • Multiple cell lines or tissue types to confirm observations

  • Experimental design controls:

    • Appropriate statistical sample sizes

    • Randomization of experimental groups

    • Blinding of analysis where appropriate

These controls help distinguish true biological effects from technical artifacts and establish the specificity of reagents and methods.

Advanced Research Questions

  • How can CRISPR-Cas9 technology be optimized for studying Arl6ip6 function in mice?

CRISPR-Cas9 offers powerful approaches for investigating Arl6ip6 function through genome editing:

  • Guide RNA design strategy:

    • Target conserved functional domains of Arl6ip6

    • Design multiple gRNAs targeting different exons to increase success rates

    • Use computational tools to minimize off-target effects

    • Consider targeting early exons for complete loss-of-function

  • Delivery approaches:

    • For germline editing: microinjection into zygotes

    • For tissue-specific studies: AAV or lentiviral delivery with tissue-specific promoters

    • For cellular models: transfection or electroporation of CRISPR components

  • Editing verification methods:

    • T7 endonuclease assay for initial screening

    • Sanger sequencing to confirm exact mutations

    • qPCR and Western blotting to verify expression changes

    • Functional assays to confirm phenotypic effects

  • Advanced editing strategies:

    • Conditional knockout using Cre-loxP or similar systems

    • Knock-in of specific mutations to study protein domains

    • Endogenous tagging for visualization without overexpression artifacts

Both homozygous and heterozygous models should be characterized to understand gene dosage effects and potential compensatory mechanisms.

  • What protein interactions of mouse Arl6ip6 have been identified, and how can they be studied?

Several predicted functional partners of rat Arl6ip6 have been identified through database analysis :

Protein PartnerDescriptionConfidence Score
Mrps9Mitochondrial ribosomal protein S90.573
Rnf122RING-type domain-containing protein0.571
RGD1560248Formin-like 20.551
Clk3Dual specificity protein kinase CLK30.535
Atad2bATPase family, AAA domain-containing 2B0.535
Bcl2l15Bcl-2 family protein0.524
Mrps3128S ribosomal protein S31, mitochondrial0.511

For human ARL6IP6, interaction with NAA50 (N-alpha-acetyltransferase) has been detected by affinity capture-MS with high confidence (score: 0.934615152) .

To study these interactions experimentally:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against Arl6ip6 to pull down complexes

    • Identify interacting partners by mass spectrometry

    • Confirm specific interactions with reciprocal Co-IPs

  • Proximity labeling:

    • BioID or APEX2 fusion with Arl6ip6

    • Identify proteins in proximity through biotinylation

    • Validate interactions with orthogonal methods

  • Fluorescence techniques:

    • FRET or BiFC to visualize interactions in living cells

    • Co-localization studies with super-resolution microscopy

    • FLIM-FRET for quantitative interaction analysis

  • Genetic approaches:

    • Synthetic lethality screens

    • Mammalian two-hybrid assays

    • Suppressor/enhancer genetic screens

These approaches should be combined for comprehensive interaction mapping.

  • What roles does Arl6ip6 play in ADP-ribosylation processes?

While the specific role of mouse Arl6ip6 in ADP-ribosylation isn't directly described in the search results, we can infer potential functions based on available data:

ADP-ribosylation is a post-translational modification catalyzed by ADP-ribosyltransferases, including the PARP family of proteins . This modification exists in several forms: mono-ADP-ribosylation (MAR), oligo-ADP-ribosylation, and poly-ADP-ribosylation (PAR) .

Given that Arl6ip6 is named as an "ADP ribosylation factor like GTPase 6 interacting protein," it likely:

  • Interacts with ARL6, a GTPase in the ARF family of proteins involved in membrane trafficking and signaling

  • May function in regulating ADP-ribosylation processes, possibly as a scaffold or regulatory protein

  • Could be subject to ADP-ribosylation itself as a regulatory mechanism

To investigate Arl6ip6's role in ADP-ribosylation:

  • Employ recombinant antibody-like ADP-ribose binding proteins to detect ADP-ribosylation in the presence/absence of Arl6ip6

  • Use ARH3 and TARG1 hydrolases as tools to investigate specific amino acid ADP-ribosylation

  • Perform in vitro ADP-ribosylation assays with recombinant proteins

  • Analyze changes in global ADP-ribosylation patterns in Arl6ip6 knockout models

These approaches could clarify whether Arl6ip6 functions as a regulator, substrate, or scaffold in ADP-ribosylation pathways.

  • How is Arl6ip6 involved in cellular signaling pathways?

The search results provide indirect evidence about Arl6ip6's potential role in signaling:

  • GTPase-related signaling: As an interacting partner of ARL6 (an ARF-like GTPase), Arl6ip6 likely participates in GTP-dependent signaling cascades. ARF6, another member of this family, regulates actin cytoskeleton rearrangements and membrane trafficking, including G-protein coupled receptor internalization .

  • Phosphoinositide signaling: Related ARF family proteins respond to phosphatidylinositol signaling . Search result shows that ARF6 co-localizes with GRP1 in membrane ruffles in response to insulin and EGF stimulation, suggesting involvement in receptor tyrosine kinase signaling pathways.

  • Potential mitochondrial signaling: Interaction partners of rat Arl6ip6 include mitochondrial ribosomal proteins , suggesting possible involvement in mitochondrial function or signaling.

To investigate Arl6ip6's role in signaling:

  • Perform phosphoproteomic analysis in Arl6ip6-deficient cells following various stimuli

  • Use proximity labeling to identify signaling components near Arl6ip6

  • Employ live-cell reporters to track signaling dynamics with and without Arl6ip6

  • Analyze changes in ARF6 activation (GTP loading) in the presence/absence of Arl6ip6

These approaches could reveal whether Arl6ip6 functions as a scaffold, regulator, or effector in specific signaling pathways.

  • What disease associations have been identified for Arl6ip6?

Several disease associations have been identified for ARL6IP6, primarily in humans:

  • Ischemic stroke: Human ARL6IP6 has been implicated by genome-wide association studies as a susceptibility locus for ischemic stroke in young adults .

  • Cutis Marmorata Telangiectatica Congenita (CMTC): A homozygous truncating mutation in ARL6IP6 was identified as the likely cause of a syndromic form of CMTC associated with major dysmorphism, developmental delay, transient ischemic attacks, and cerebral vascular malformations .

  • Cancer relevance: While not specifically for ARL6IP6, search result discusses ARL-6 in hepatocellular carcinoma, showing correlations with survival outcomes and immune cell infiltration.

For investigating disease associations in mouse models:

  • Generate Arl6ip6 knockout or mutation models mirroring human disease variants

  • Employ relevant disease challenge models (e.g., stroke models, vascular development assays)

  • Analyze vascular development and function in Arl6ip6-deficient mice

  • Perform immune cell infiltration analysis in disease contexts

These findings suggest that Arl6ip6 might represent an important link between Mendelian disorders and complex diseases like stroke, with mouse models potentially providing valuable insights into pathogenic mechanisms.

  • What sample preparation methods optimize Arl6ip6 detection in different experimental settings?

Sample preparation significantly impacts Arl6ip6 detection, especially considering its potential roles in ADP-ribosylation processes:

  • Protein extraction for immunoblotting:

    • Use buffers containing appropriate protease inhibitors

    • Include phosphatase inhibitors if studying phosphorylation status

    • Consider different lysis conditions (RIPA vs. NP-40 vs. Triton X-100)

    • Test both denaturing and native conditions depending on antibody requirements

  • Fixation for microscopy:

    • Search result indicates that fixation method dramatically affects localization patterns of ADP-ribosylation

    • Compare paraformaldehyde, methanol, and acetone fixation

    • Document different patterns observed with different fixatives

    • Consider live-cell imaging to avoid fixation artifacts

  • Preservation of post-translational modifications:

    • Include PARP inhibitors when studying ADP-ribosylation

    • Use NAD+ analogs for metabolic labeling of ADP-ribosylated proteins

    • Consider crosslinking approaches to capture transient interactions

  • Subcellular fractionation:

    • Optimize protocols for separating cytosolic, membrane, nuclear, and mitochondrial fractions

    • Include markers for each fraction to verify clean separation

    • Analyze Arl6ip6 distribution across fractions under different conditions

Researchers should always validate findings using complementary techniques and include appropriate controls to distinguish true localization from artifacts.

  • What are the methodological considerations for studying post-translational modifications of Arl6ip6?

Given Arl6ip6's relationship to ADP-ribosylation factors, post-translational modifications likely play key roles in its function:

  • Identification strategies:

    • Mass spectrometry analysis following enrichment of modified peptides

    • Phospho-specific antibodies for phosphorylation sites

    • ADP-ribose binding domains for ADP-ribosylation

    • Site-directed mutagenesis of predicted modification sites

  • Enrichment methods:

    • Phosphopeptide enrichment using TiO2 or IMAC

    • Use of engineered binding domains specific for ADP-ribose moieties

    • Ubiquitin-binding domains for ubiquitinated proteins

    • Acetyl-lysine antibodies for acetylation

  • Dynamic analysis:

    • Pulse-chase experiments to determine modification turnover rates

    • Analysis after various cellular stimuli to identify regulatory events

    • Inhibitor studies to block specific modification pathways

  • Functional assessment:

    • Generation of modification-site mutants (phosphomimetic or phosphodeficient)

    • Analysis of protein interactions, localization, and stability with modified vs. unmodified protein

    • In vitro reconstitution with selectively modified protein

These approaches can reveal how post-translational modifications regulate Arl6ip6 function and interactions in different cellular contexts.

  • What experimental design approaches can help resolve contradictory findings about Arl6ip6 function?

Reconciling contradictory findings requires systematic approaches:

  • Methodological standardization:

    • Standardize detection methods across studies

    • Document fixation protocols, antibody lots, and experimental conditions

    • Develop reporting standards for Arl6ip6 research

  • Multi-approach validation:

    • Employ complementary techniques to study the same phenomenon

    • Combine genetic, biochemical, and imaging approaches

    • Use both gain-of-function and loss-of-function experiments

  • Context consideration:

    • Systematically test Arl6ip6 function across different cell types

    • Analyze developmental time points to identify stage-specific functions

    • Test multiple stimuli to identify condition-specific roles

  • Targeted experimental design:

    • Design experiments specifically to test competing hypotheses

    • Include appropriate controls that can distinguish between alternatives

    • Consider temporal dynamics and kinetic measurements

  • Meta-analysis approach:

    • Systematically compare methodologies across studies reporting contradictory results

    • Identify potential confounding variables

    • Develop consensus models that integrate apparently contradictory findings

This systematic approach can help determine whether contradictions reflect true biological complexity or methodological differences.

  • How can the subcellular localization of Arl6ip6 be accurately determined?

Determining Arl6ip6 subcellular localization requires careful consideration of methodological variables:

  • Fixation effects:

    • Search result indicates fixation methods dramatically affect localization patterns

    • Compare multiple fixation protocols systematically

    • Document differences observed with each method

    • Consider that the "true" localization may be a composite of different patterns

  • Complementary approaches:

    • Biochemical fractionation with markers for different compartments

    • Live-cell imaging with fluorescent protein fusions

    • Proximity labeling methods (BioID, APEX2) to identify neighboring proteins

    • Immunoelectron microscopy for high-resolution localization

  • Endogenous vs. overexpression:

    • Prioritize detection of endogenous protein when possible

    • Use CRISPR knock-in tagging strategies for physiological expression

    • If overexpression is necessary, use inducible systems with titrated expression

  • Dynamic localization:

    • Track localization changes in response to stimuli

    • Use photoactivatable or photoconvertible tags for pulse-chase experiments

    • Employ FRAP (Fluorescence Recovery After Photobleaching) to study mobility

  • Validation controls:

    • Include known markers for cellular compartments

    • Use super-resolution microscopy for detailed co-localization analysis

    • Confirm patterns with multiple antibodies or epitope tags

This multi-faceted approach can provide more reliable information about Arl6ip6's true subcellular distribution and its potential regulation.

  • What strategies can enhance the specificity and reproducibility of Arl6ip6 functional studies?

To maximize the rigor of Arl6ip6 research:

  • Reagent validation:

    • Verify antibody specificity using knockout controls

    • Validate siRNA/shRNA efficiency and specificity

    • Characterize CRISPR-edited cell lines thoroughly

    • Sequence verify all expression constructs

  • Comprehensive controls:

    • Include positive and negative controls for all experiments

    • Use multiple siRNAs targeting different regions

    • Rescue experiments to confirm specificity of observed phenotypes

    • Include isotype controls for immunoprecipitation

  • Methodological transparency:

    • Detailed reporting of experimental conditions

    • Sharing of protocols, reagents, and raw data

    • Documentation of cell passage numbers and authentication

    • Disclosure of sample sizes and statistical approaches

  • Orthogonal validation:

    • Confirm key findings using multiple techniques

    • Reproduce results in different cell types or model systems

    • Use both gain-of-function and loss-of-function approaches

    • Validate in vivo findings in vitro and vice versa

  • Advanced experimental design:

    • Consider factorial designs to test multiple variables

    • Use dose-response relationships rather than single concentrations

    • Implement blinding and randomization where appropriate

    • Employ appropriate statistical methods for complex datasets

These strategies will increase confidence in findings about Arl6ip6 function and facilitate the integration of results across different studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.