Recombinant Mouse ADP/ATP translocase 1 (Slc25a4)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Characteristics

ADP/ATP translocase 1, encoded by the Slc25a4 gene (human ortholog SLC25A4), is a member of the mitochondrial carrier subfamily of solute carrier proteins. This protein forms a homodimeric complex embedded within the inner mitochondrial membrane, where it functions as a gated pore for the exchange of adenine nucleotides . The mouse Slc25a4 protein shares significant homology with its human counterpart and is also known by several synonyms including ADP, ATP carrier protein 1, adenine nucleotide translocator 1, ANT1, and mANC1 . As a member of the larger mitochondrial carrier family, Slc25a4 exhibits the characteristic structural features that enable selective transport across the mitochondrial inner membrane while maintaining the crucial electrochemical gradient necessary for oxidative phosphorylation.

The protein contains multiple transmembrane domains that create a channel through which adenine nucleotides can pass. This specific arrangement allows for the precise control of metabolite movement between the mitochondrial matrix and the cytoplasm. The functional importance of Slc25a4 is highlighted by its high conservation across species, reflecting the fundamental role it plays in cellular bioenergetics. The recombinant form of mouse Slc25a4 produced for research purposes maintains these structural characteristics, enabling detailed investigation of its functions in controlled experimental systems.

Physiological Function

The primary physiological function of Slc25a4 is to catalyze the exchange of cytoplasmic ADP with mitochondrial ATP across the inner mitochondrial membrane . This exchange is fundamental to cellular energy metabolism, as it provides ATP synthesized in the mitochondria to the cytoplasm for cellular processes while simultaneously supplying ADP to the mitochondrial matrix for continued ATP production via oxidative phosphorylation. This bidirectional transport mechanism creates a cycle that sustains energy production and utilization throughout the cell.

Interestingly, Slc25a4 also exhibits dual transport functions beyond nucleotide exchange. Research indicates that it can function as a proton transporter, contributing to mitochondrial uncoupling and thermogenesis . This proton transport activity is inhibited by its ADP/ATP antiporter activity, suggesting that Slc25a4 acts as a master regulator of mitochondrial energy output by maintaining a delicate balance between ATP production and heat generation . Additionally, studies have revealed that Slc25a4 plays a role in the mitochondrial permeability transition pore (mPTP) opening, although its exact contribution—whether as a pore-forming component or a regulator—remains under investigation .

Significance in Mitochondrial Biology

Beyond its direct role in bioenergetics, Slc25a4 has emerged as a crucial player in broader aspects of mitochondrial biology. Recent research has uncovered its unexpected involvement in mitophagy, the selective degradation of damaged mitochondria. Surprisingly, this function appears to be independent of its nucleotide translocase activity . The protein interacts with components of the mitochondrial import machinery, particularly the TIM23 complex and TIM44, to regulate the stabilization of PINK1, a kinase essential for initiating mitophagy in response to mitochondrial damage .

Expression Systems

The production of recombinant mouse Slc25a4 typically involves advanced expression systems capable of generating properly folded membrane proteins. While the search results don't provide specific details about the expression systems used for mouse Slc25a4, membrane proteins like translocases are commonly expressed in eukaryotic systems such as yeast or insect cells using baculovirus expression vectors. These systems offer advantages for membrane protein production compared to bacterial systems, as they provide a eukaryotic membrane environment and post-translational modification machinery more similar to that of mammalian cells.

For research applications, recombinant Slc25a4 is produced with various tags to facilitate purification and detection. These tags can include polyhistidine (His) tags, FLAG tags, or other affinity tags that enable selective isolation of the target protein from the complex mixture of cellular components. The expression conditions are typically optimized to balance protein yield with proper folding and functionality, as membrane proteins often present challenges in recombinant production due to their hydrophobic nature and complex topology.

Purification Techniques

After expression, recombinant mouse Slc25a4 must be carefully extracted from cellular membranes and purified to homogeneity while maintaining its native structure and function. This process typically begins with selective membrane solubilization using detergents that can extract the protein from the lipid bilayer without causing denaturation. Common detergents used for mitochondrial carrier proteins include mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin.

Following solubilization, the protein is purified using affinity chromatography that targets the engineered tags on the recombinant protein. Additional purification steps may include ion exchange chromatography, size exclusion chromatography, or other techniques to achieve high purity. Throughout the purification process, care must be taken to maintain the protein in a stable buffer environment that preserves its structural integrity and functional properties. The purified recombinant Slc25a4 can then be used directly for biochemical and functional studies or reconstituted into artificial membrane systems such as liposomes for transport assays.

Quality Control and Verification

To ensure the reliability of experimental results, recombinant mouse Slc25a4 undergoes rigorous quality control and verification procedures. These typically include assessment of protein purity by SDS-PAGE, Western blotting with specific antibodies, and mass spectrometry analysis to confirm protein identity. The oligomeric state of the purified protein is often evaluated using techniques such as native gel electrophoresis, analytical ultracentrifugation, or size exclusion chromatography coupled with multi-angle light scattering.

Functional verification is particularly important for transport proteins like Slc25a4. This can involve measuring ADP/ATP exchange activity using either radioactive substrates or fluorescence-based assays, as described in the search results . The specific inhibition of transport activity by known inhibitors such as bongkrekic acid and carboxyatractyloside serves as a valuable control to confirm that the purified recombinant protein retains its native functional properties . These quality control measures ensure that the recombinant mouse Slc25a4 used in research accurately represents the biological characteristics of the endogenous protein.

ADP/ATP Exchange Mechanism

The fundamental function of Slc25a4 is the exchange of ADP and ATP across the inner mitochondrial membrane. Recombinant mouse Slc25a4 reconstituted into unilamellar liposomes has been shown to mediate this exchange with an activity rate of approximately 3.49 ± 0.41 mmol/min/g, comparable to values measured in intact mitochondria . This exchange follows a strict 1:1 stoichiometry, where one molecule of ADP is transported in one direction while one molecule of ATP is transported in the opposite direction.

The transport mechanism involves conformational changes in the protein that alternately expose binding sites to either side of the membrane. The exchange process is electrogenic, as ATP carries an additional negative charge compared to ADP, resulting in a net movement of charge across the membrane with each exchange cycle. This process is tightly regulated and can be specifically inhibited by compounds such as bongkrekic acid and carboxyatractyloside, which bind to different conformational states of the protein and prevent the structural changes necessary for transport .

Research using recombinant Slc25a4 has enabled detailed analysis of the transport kinetics and the factors that influence exchange rates. Studies have revealed that the ADP/ATP exchange rate calculated from Magnesium Green (MgGr™) fluorescence measurements solely depends on the Slc25a4 content in liposomes, confirming the direct relationship between protein concentration and transport activity . This quantitative relationship provides valuable information about the intrinsic catalytic properties of the translocase independent of other cellular factors.

Interaction with Other Proteins

Recombinant Slc25a4 studies have revealed previously unrecognized interactions with other mitochondrial proteins, particularly components of the protein import machinery. The protein has been shown to interact with TIM23, a central component of the presequence translocase that mediates protein import into mitochondria . This interaction appears to be critical for the role of Slc25a4 in mitophagy regulation, as it allows the protein to influence TIM23 activity in response to changes in mitochondrial bioenergetic status.

Additionally, Slc25a4 interacts with TIM44, a protein known to regulate peptide import through the TIM23 complex . This interaction provides a mechanistic link between Slc25a4 and the modulation of protein translocation into mitochondria. Interestingly, disease-causing mutations in human ANT1 (A90D and A123D) disrupt binding to TIM44 and TIM23, consequently inhibiting mitophagy . These findings highlight how recombinant protein studies have expanded our understanding of Slc25a4 beyond its classical role in nucleotide exchange to include broader functions in mitochondrial regulation.

The interaction network of Slc25a4 also extends to proteins involved in the formation or regulation of the mitochondrial permeability transition pore (mPTP). Although the exact composition of this pore remains controversial, evidence suggests that Slc25a4 contributes to its function either as a structural component or as a regulatory factor . These protein-protein interactions represent important targets for future research using recombinant Slc25a4 to better understand the molecular mechanisms underlying mitochondrial responses to stress and damage.

Regulatory Mechanisms

Post-translational modifications represent another important regulatory layer. Although not specifically mentioned in the search results for mouse Slc25a4, studies on ANT proteins have identified modifications such as phosphorylation, acetylation, and oxidation that can alter transport properties and interactions with other proteins. Recombinant systems provide valuable tools for investigating how these modifications affect protein function under controlled conditions.

The dual functionality of Slc25a4 as both an ADP/ATP exchanger and a proton transporter introduces additional regulatory complexity. The proton transport activity requires free fatty acids as cofactors but does not transport them directly . This activity is inhibited by the protein's ADP/ATP antiporter function, suggesting an intricate regulatory mechanism that balances energy production (ATP synthesis) and energy dissipation (thermogenesis) based on cellular needs . The ability to study these competing functions using purified recombinant protein in defined membrane environments offers unique insights into the molecular switches that govern mitochondrial energy distribution.

In Vitro Studies and Assays

Recombinant mouse Slc25a4 serves as a valuable tool for in vitro studies aimed at understanding the fundamental properties and functions of this important mitochondrial carrier. One significant advantage of using recombinant protein is the ability to precisely control experimental conditions and isolate the specific activity of Slc25a4 from other cellular components that might influence its behavior. This controlled environment allows researchers to directly attribute observed effects to the protein itself, providing clearer insights into its intrinsic properties.

In vitro assays using recombinant Slc25a4 include studies of binding affinities for various substrates and inhibitors, investigation of conformational changes during the transport cycle, and characterization of the effects of pH, membrane potential, and other physical parameters on transport activity. The protein can also be used to screen for novel modulators of mitochondrial transport, potentially leading to the development of compounds with therapeutic applications in mitochondrial disorders.

An important application involves the reconstitution of recombinant Slc25a4 into artificial membrane systems such as liposomes. This approach allows for the detailed investigation of transport mechanisms in a simplified environment that nevertheless retains the essential features required for protein function. As noted in the search results, this model system enables direct measurement of ADP/ATP exchange rates that are specifically dependent on Slc25a4 activity .

ELISA-Based Detection

Commercial ELISA kits for mouse Slc25a4 measurement represent a significant application of recombinant protein technology in research and clinical settings. These kits typically use antibodies generated against recombinant Slc25a4 to detect and quantify the protein in various biological samples. According to the search results, the Mouse ADP/ATP Translocase 1 (Slc25a4) ELISA Kit is designed for the precise measurement of Slc25a4 levels in mouse samples, including serum, plasma, and cell culture supernatants .

The sandwich enzyme immunoassay technique employed in these kits relies on antibodies specific for mouse Slc25a4 that have been pre-coated onto microplates . Standards and samples are added to the wells, allowing any Slc25a4 present to bind to the immobilized antibody. After washing, a detection antibody specific for Slc25a4 is added, followed by an enzyme conjugate and substrate solution that develops color in proportion to the amount of Slc25a4 bound in the initial step .

Table 1: Characteristics of the Mouse ADP/ATP translocase 1 (Slc25a4) ELISA Kit

ParameterSpecification
Product NameMouse ADP/ATP translocase 1 (Slc25a4) ELISA Kit
TargetMouse ADP/ATP translocase 1 (Slc25a4)
SynonymsADP, ATP carrier protein 1, ADP, ATP carrier protein, heart/skeletal muscle isoform T1, Adenine nucleotide translocator 1, Solute carrier family 25 member 4, mANC1, ANT 1, Anc1, Ant1
Assay TypeSandwich
Detection MethodELISA
ReactivityMouse
Detection Range0.156-10 ng/mL
Sensitivity0.067 ng/mL
FunctionCatalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane
UniprotP48962
Sample TypeSerum, plasma, tissue homogenates

These ELISA kits offer exceptional sensitivity and specificity, with detection ranges typically from 0.156-10 ng/mL and sensitivity around 0.067 ng/mL . This high performance enables researchers to accurately measure Slc25a4 levels in experimental settings, providing valuable data for studies of mitochondrial function, disease mechanisms, and potential therapeutic interventions.

Liposome Reconstitution Studies

A particularly powerful application of recombinant mouse Slc25a4 involves its reconstitution into liposomes for functional transport studies. This approach overcomes the limitations of measuring carrier activity in intact cells or mitochondria, where multiple transporters and metabolic pathways can complicate the interpretation of results. In liposome systems, the experimental conditions can be precisely defined, and the transport activity can be directly attributed to the reconstituted Slc25a4 protein.

The search results describe a fluorescence-based method using Magnesium Green (MgGr™), a Mg²⁺-sensitive dye suitable for measurement in liposomes . This technique exploits the different binding affinities of Mg²⁺ for ATP and ADP to detect changes in their concentrations during transport. Proteoliposomes are filled with MgGr™, Mg²⁺, and ATP, and the addition of external ADP initiates ATP exchange with ADP through Slc25a4. This exchange leads to increased binding of Mg²⁺ to MgGr™, resulting in a time-dependent increase in fluorescence intensity that can be converted to ADP/ATP exchange rates .

Using this approach, researchers obtained an ADP/ATP exchange rate of 3.49 ± 0.41 mmol/min/g for recombinant ANT1 reconstituted into unilamellar liposomes, comparable to values measured in mitochondria using radioactivity assays . This fluorescence-based method provides a valuable alternative to radioactive techniques, which are expensive and require stringent precautions. The specific inhibition of exchange by bongkrekic acid and carboxyatractyloside confirms that the measured activity is indeed mediated by Slc25a4, validating the assay's specificity .

Investigation of Disease Mutations

Recombinant Slc25a4 provides an excellent platform for investigating the effects of disease-associated mutations on protein function. By introducing specific mutations into the recombinant protein and studying their impact on transport activity, protein stability, and interactions with other molecules, researchers can gain insights into the molecular mechanisms underlying mitochondrial disorders linked to SLC25A4 mutations.

The search results mention that human mutations in ANT1 (the human ortholog of mouse Slc25a4) have been associated with autosomal dominant progressive external ophthalmoplegia and familial hypertrophic cardiomyopathy . Specific mutations such as A90D and A123D have been shown to abrogate binding to TIM44 and TIM23 and inhibit mitophagy . In contrast, an ATP-binding mutant (K43E/R244E) retained the ability to interact with these proteins and rescue the suppression of TIM23 in cells lacking ANT1 .

These findings illustrate how recombinant protein studies can reveal the functional consequences of disease-causing mutations at the molecular level. Such information is crucial for understanding pathogenic mechanisms and potentially developing targeted therapeutic approaches. The ability to produce and characterize mutant forms of Slc25a4 in a controlled experimental system represents a powerful advantage of recombinant protein technology in biomedical research.

Mitophagy Regulation

One of the most surprising discoveries about Slc25a4 function, revealed through studies using recombinant proteins and genetic models, is its critical role in mitophagy regulation. Unexpectedly, this function is independent of its canonical activity as an ADP/ATP exchanger . Research has shown that the adenine nucleotide translocator (ANT) complex is required for mitophagy in multiple cell types, with genetic ablation of ANT paradoxically suppressing mitophagy despite the fact that pharmacological inhibition of ANT-mediated ADP/ATP exchange promotes it .

The mechanism underlying this role involves the interaction of Slc25a4 with the protein import machinery. Specifically, ANT is required for inhibition of the presequence translocase TIM23 in response to bioenergetic collapse, which leads to PINK1 stabilization—a key initial step in the mitophagy process . ANT modulates TIM23 indirectly via interaction with TIM44, a known regulator of peptide import through TIM23 . These molecular interactions position ANT as a sensor of mitochondrial energetic status that can trigger quality control mechanisms when energy production is compromised.

This regulatory function has significant implications for mitochondrial homeostasis and cellular health. Mice lacking ANT1 exhibit blunted mitophagy and consequent profound accumulation of aberrant mitochondria . This observation underscores the physiological importance of Slc25a4 beyond its role in energy exchange and highlights how disruption of this function can lead to mitochondrial dysfunction and potentially contribute to disease pathogenesis.

Implications in Disease Models

The multifunctional nature of Slc25a4 makes it a critical factor in various disease models, particularly those involving mitochondrial dysfunction. As mentioned earlier, mutations in the human SLC25A4 gene have been associated with several disorders, including progressive external ophthalmoplegia with mitochondrial DNA deletions, autosomal dominant 2, and mitochondrial DNA depletion syndrome 12A . These conditions typically manifest with features related to impaired energy metabolism, such as muscle weakness, exercise intolerance, and cardiomyopathy.

The search results specifically mention that disease-causing human mutations in ANT1 (A90D and A123D) abrogate binding to TIM44 and TIM23 and inhibit mitophagy . This finding provides a mechanistic link between specific mutations and pathological consequences, suggesting that impaired mitophagy and the resulting accumulation of damaged mitochondria may contribute to disease progression. This perspective expands our understanding of these disorders beyond simple bioenergetic deficits to include defects in mitochondrial quality control.

Research using recombinant Slc25a4 in disease models can help elucidate the specific molecular pathways disrupted by different mutations and identify potential points for therapeutic intervention. By characterizing how various mutations affect different functions of the protein—nucleotide transport, proton leakage, interactions with other proteins, or mitophagy regulation—researchers can develop more targeted approaches to address the underlying pathogenic mechanisms in SLC25A4-related disorders.

Therapeutic Potential

The diverse functions of Slc25a4 and its central role in mitochondrial physiology make it an intriguing target for therapeutic development. Recombinant mouse Slc25a4 provides a valuable tool for screening and characterizing compounds that might modulate its activity in ways beneficial for treating mitochondrial disorders. Such compounds could potentially enhance deficient functions or inhibit excessive activities depending on the specific pathological context.

For disorders associated with impaired mitophagy due to SLC25A4 mutations, approaches aimed at restoring or bypassing the mitophagy-promoting function of ANT might be beneficial. Alternatively, for conditions involving excessive mitochondrial permeability or inappropriate apoptosis, modulators that stabilize ANT in configurations less conducive to pore formation could offer therapeutic benefits. The ability to test such compounds using purified recombinant protein in controlled systems provides an efficient path for initial drug discovery efforts.

Beyond direct targeting of Slc25a4, understanding its regulatory networks and interaction partners opens additional avenues for therapeutic intervention. By identifying the molecular mechanisms through which Slc25a4 senses mitochondrial stress and communicates with quality control machinery, researchers might discover alternative targets within these pathways that could be modulated to achieve similar beneficial effects. This systems-level approach, facilitated by recombinant protein studies, holds promise for developing more comprehensive strategies to address the complex pathophysiology of mitochondrial disorders.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc25a4; Aac1; Anc1; Ant1; ADP/ATP translocase 1; ADP,ATP carrier protein 1; ADP,ATP carrier protein, heart/skeletal muscle isoform T1; Adenine nucleotide translocator 1; ANT 1; Solute carrier family 25 member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-298
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
GDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSV QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
Uniprot No.

Target Background

Function
ADP/ATP antiporter (ANT1) is a mitochondrial membrane protein responsible for mediating the exchange of ADP and ATP between the mitochondrial matrix and the cytosol. This exchange is crucial for ATP synthesis and cellular energy production. ANT1 operates by an alternating access mechanism, where a single substrate-binding site is alternately exposed to either the cytosolic or matrix side of the inner mitochondrial membrane. Besides its primary function as an ADP/ATP exchanger, ANT1 is also implicated in mitochondrial uncoupling and the mitochondrial permeability transition pore (mPTP) activity.

ANT1 contributes to mitochondrial uncoupling by acting as a proton transporter. This uncoupling reduces the efficiency of ATP production and promotes mitochondrial thermogenesis. Proton transport activity is inhibited by ADP/ATP antiporter activity, suggesting that ANT1 acts as a central regulator of mitochondrial energy output, maintaining a balance between ATP production and thermogenesis. Proton transporter activity requires free fatty acids as a cofactor but does not transport them. ANT1 likely mediates mitochondrial uncoupling in tissues that do not express UCP1.

ANT1 plays a crucial role in mPTP opening, a non-specific pore that allows free passage of solutes up to 1.5 kDa through the mitochondrial membranes, contributing to cell death. However, the precise role of ANT1 as a pore-forming component of mPTP or a regulatory factor remains unclear.

ANT1 independently regulates mitophagy through its interaction with TIMM44. This interaction leads to inhibition of the presequence translocase TIMM23, stabilizing PINK1 and promoting mitophagy.
Gene References Into Functions
  1. ANT1-deficient muscle mitochondria exhibit increased reactive oxygen species (ROS) production and partial uncoupling, resulting in enhanced muscle respiration under nonphosphorylating conditions. Muscle transcriptome analysis reveals upregulation of mitochondrial biogenesis, downregulation of diabetes-related genes, and increased expression of genes encoding the myokines FGF21 and GDF15. PMID: 28223503
  2. ANT1 can induce autoimmune myocarditis in A/J mice by generating autoreactive T cells. PMID: 27876151
  3. miR-2861 and ANT1 are key regulators of cardiomyocyte necrosis and myocardial infarction. PMID: 26654759
  4. These findings suggest that follicular helper T cells and IL-21 might be involved in the pathogenesis of viral myocarditis and play a significant role in anti-ANT autoantibody production. PMID: 25889760
  5. Data indicate that palmitoyl-carnitine (PC) increases type 2 ryanodine receptor (RyR2) oxidation and reduces ATP/ADP translocase (ANT) activity. PMID: 25619687
  6. Downregulation of adenine nucleotide translocator 1 exacerbates tumor necrosis factor-alpha-mediated cardiac inflammatory responses. PMID: 25380814
  7. Mutations in ANT1 are linked to some cases of inherited Parkinson disease. PMID: 24325796
  8. Plasma membrane-localized ANT1 and ANT2 regulate L1-mediated neurite outgrowth in conjunction with MMP14. PMID: 22423112
  9. Although the precise molecular mechanism connecting ANT1-Cys(57) nitroalkylation and uncoupling remains unknown, these findings suggest that ANT1-mediated uncoupling may be a mechanism for nitroalkene-induced cardioprotection. PMID: 22158628
  10. The attenuation of ANT-1 in the presence of PGC-1alpha overexpression preserves the mitochondrial membrane potential in response to hydrogen-peroxide stress. PMID: 20600099
  11. Data demonstrate that ANT1 protein levels are upregulated in Mecp2-null mice. PMID: 20504995
  12. uncoupling protein-3 can minimize the induction of the adenine nucleotide translocase-mediated 'energy-wasting' process during Calorie restriction (CR). PMID: 20206124
  13. The astrocytic response to CNS injury includes an apparent increase in energy mobilization capacity by Ant1, contributing to neuroprotective, energy-dependent glutamate uptake. PMID: 12781988
  14. ANTs are non-essential structural components of the mitochondrial permeability transition pore, although they contribute to its regulation. PMID: 14749836
  15. Half to two-thirds of the basal proton conductance of mitochondria is catalyzed by the adenine nucleotide carrier, independent of its ATP/ADP exchange or fatty-acid-dependent proton-leak functions. PMID: 16076285
  16. The ANT1 isoform may mediate a significant part of the high basal proton leak in brown-fat mitochondria. PMID: 16831128
  17. The Ant1 deficient mouse skeletal muscle demonstrates that energy metabolism, antioxidant defenses, and apoptosis form an integrated metabolic network. PMID: 18439414
  18. Cardiomyocyte-restricted overexpression of ANT1 prevents the development of diabetic cardiomyopathy; therefore, accelerated ADP/ATP exchange could be a promising therapeutic target for diabetic cardiomyopathy. PMID: 18945756
  19. Inhibition by cyclosporin A prevents pyrazole plus lipopolysaccharide-induced liver injury. PMID: 19026739
  20. The mitochondrial membrane potential of Ant1-deficient brain mitochondria is increased, and the permeability transition pore is more resistant to calcium-induced permeability transition. PMID: 19366611
  21. Data indicate that ANT mediates cell death, not through the MPT pore, but rather via a ROS-dependent upregulation and activation of Bax. PMID: 19452617

Show More

Hide All

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in heart, skeletal muscle and brain.

Q&A

What is ADP/ATP translocase 1 (Slc25a4) and how does it differ from other translocase isoforms?

ADP/ATP translocase 1 (Slc25a4), also known as adenine nucleotide translocase-1 (ANT1), is a critical mitochondrial inner membrane protein that facilitates the exchange of cytosolic ADP for mitochondrial ATP. It belongs to the SLC25 family of mitochondrial carrier proteins with a primary role in energy metabolism. While Slc25a4 (ANT1) and Slc25a31 (ANT4) share functional similarities as ADP/ATP transporters, they differ in tissue distribution and specific physiological roles . The ANT1 isoform is predominantly expressed in highly metabolic tissues like heart and skeletal muscle, whereas ANT4 (Slc25a31) has more limited expression patterns. Both proteins contain approximately 320 amino acids forming six transmembrane domains, but their sequence identity is around 70-80%, leading to subtle functional differences .

What is the structural organization of recombinant Slc25a4 protein?

Recombinant Slc25a4 is typically expressed as a full-length protein (approximately 320 amino acids) with a molecular weight of about 32 kDa. The functional unit of ANT1 is a homodimer consisting of two 32 kD proteins, containing six hydrophobic transmembrane sheet layers and three homology domains . These transmembrane domains form a barrel-like structure that creates the translocation pathway for adenine nucleotides. For recombinant expression, the protein is often tagged (commonly with His-tag) at either the N- or C-terminus to facilitate purification, similar to the approach used for Slc25a31 . The transmembrane nature of Slc25a4 necessitates specific buffer conditions containing appropriate detergents to maintain protein stability and functionality during purification and subsequent applications.

Where is Slc25a4 localized within cells and how can this be visualized experimentally?

Slc25a4 is exclusively localized to the inner mitochondrial membrane where it functions as an essential component of the cellular energy transfer system . This localization can be experimentally confirmed through several complementary techniques. Subcellular fractionation followed by Western blot analysis can demonstrate the presence of Slc25a4 in mitochondrial fractions but not in cytosolic fractions . For more precise localization, researchers can employ proteinase K digestion assays, which selectively remove outer mitochondrial membrane proteins while leaving inner membrane proteins intact . Confocal microscopy using fluorescently labeled antibodies against Slc25a4 or tagged recombinant protein can provide visual confirmation of mitochondrial localization . For the highest resolution analysis, immunogold electron microscopy can definitively demonstrate inner mitochondrial membrane localization at the ultrastructural level.

What are the different conformational states of Slc25a4 and how do they regulate function?

Slc25a4 exists in two primary conformational states that are essential for its transport function and regulatory roles. In the "m-state" (matrix-facing), the protein transports ATP from the mitochondrial matrix to the intermembrane space while releasing ADP. In the "c-state" (cytoplasm-facing), it transports ADP from the intermembrane space into the matrix while releasing ATP . These conformational states can be experimentally locked using specific inhibitors: carboxyatractyloside (CATR) fixes ANT1 in the c-state, while bongkrekic acid (BKA) maintains ANT1 in the m-state . The transition between these states is critical for the protein's function and can be influenced by interactions with other proteins, such as viral proteins like EBV-LMP1, which has been shown to maintain ANT1 in the m-state . Researchers can investigate these conformational changes using liquid-phase nuclear magnetic resonance (NMR) after inserting difluorotyrosine into specific sites of ANT1 through genetic codon expansion .

How does the conformational cycling of Slc25a4 affect mitochondrial membrane potential?

The conformational cycling of Slc25a4 between its m-state and c-state has profound effects on mitochondrial membrane potential (ΔΨm). When Slc25a4 is predominantly in the m-state, it typically correlates with increased mitochondrial membrane potential and reduced opening of the mitochondrial permeability transition pore (mPTP) . Conversely, when Slc25a4 shifts toward the c-state, it promotes formation of the ANT1-VDAC1 complex, which facilitates mPTP opening and decreases mitochondrial membrane potential . Experimental evidence for this relationship comes from studies using conformational inhibitors: BKA (m-state inhibitor) treatment increases membrane potential, while CATR (c-state inhibitor) decreases it . This functional relationship can be measured using potentiometric fluorescent dyes such as TMRM or JC-1, which accumulate in mitochondria proportionally to membrane potential. Changes in membrane potential mediated by Slc25a4 conformational states have significant implications for cell survival, as higher membrane potential generally correlates with increased cell viability .

What techniques are available to study Slc25a4 conformational changes in experimental systems?

Several sophisticated techniques are available to study the conformational changes of Slc25a4:

  • 19F-NMR Spectroscopy: By inserting difluorotyrosine into specific sites of ANT1 (such as Y195 and Y290) using genetic codon expansion, researchers can detect conformational changes through shifts in fluorine signals . This technique is particularly powerful because fluorine has 100% natural abundance and is highly sensitive to changes in chemical environment.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify spatial relationships between specific amino acid residues in different conformational states.

  • Conformational Antibodies: Antibodies that specifically recognize either the m-state or c-state of Slc25a4 can be used in immunoprecipitation or immunofluorescence experiments.

  • Inhibitor Binding Assays: Using radiolabeled CATR or BKA can provide quantitative information about the proportion of Slc25a4 molecules in each conformational state.

  • FRET-based Sensors: Fluorescence resonance energy transfer sensors can be designed to report on conformational changes in real-time in living cells.

The choice of technique depends on the specific research question, with 19F-NMR offering high resolution but requiring specialized equipment, while inhibitor binding assays are more accessible but provide less detailed structural information .

What are the optimal expression systems for producing functional recombinant mouse Slc25a4?

For functional recombinant mouse Slc25a4, several expression systems can be employed, each with distinct advantages:

Yeast Expression (P. pastoris): Offers a eukaryotic environment with proper folding machinery while maintaining high yields. The mitochondrial targeting of Slc25a4 is better preserved in yeast compared to bacteria.

Insect Cell Expression (Sf9/Hi5): Provides superior folding and post-translational modifications for mammalian membrane proteins. Baculovirus-infected insect cells can produce functionally active Slc25a4 with proper membrane insertion.

Mammalian Cell Expression (HEK293/CHO): Though yields are lower, this system provides the most native-like environment for mouse Slc25a4, ensuring proper folding and function.

The choice depends on the application, with E. coli suitable for structural studies requiring high protein amounts , while mammalian systems are preferred for functional and interaction studies where native conformation is critical.

What purification strategies yield high-quality recombinant Slc25a4 suitable for functional studies?

Purifying functional Slc25a4 requires carefully optimized strategies to maintain protein stability throughout the process:

  • Membrane Extraction: Efficient extraction from membranes requires mild detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS. Detergent screening is often necessary to identify conditions that extract Slc25a4 while preserving its native conformation.

  • Affinity Chromatography: His-tagged Slc25a4 can be purified using Ni-NTA or TALON resin . Critical parameters include imidazole concentration in washing buffers (typically 20-40 mM) to reduce non-specific binding while retaining Slc25a4, and elution conditions (typically 250-300 mM imidazole).

  • Size Exclusion Chromatography: This crucial polishing step separates monomeric, dimeric, and aggregated forms of Slc25a4. The presence of a sharp, symmetrical peak corresponding to the dimeric form (~64 kDa) indicates properly folded protein.

  • Lipid Reconstitution: For functional studies, purified Slc25a4 can be reconstituted into liposomes composed of phosphatidylcholine and cardiolipin (3:1) to mimic the mitochondrial inner membrane environment.

  • Quality Control: SDS-PAGE analysis should show >90% purity , while circular dichroism can confirm proper secondary structure with predominantly α-helical content characteristic of mitochondrial carriers.

For long-term storage, addition of 6% trehalose as a stabilizing agent and storage at -80°C in small aliquots is recommended to avoid repeated freeze-thaw cycles .

How can researchers assess the functional integrity of purified recombinant Slc25a4?

Multiple complementary approaches can verify the functional integrity of purified recombinant Slc25a4:

ATP/ADP Transport Assays: The gold standard functional test involves reconstituting purified Slc25a4 into liposomes and measuring the exchange of radiolabeled ATP/ADP across the liposomal membrane. A functional protein will show time-dependent, saturable transport that is inhibited by specific inhibitors like CATR and BKA.

Inhibitor Binding Assays: Specific binding of [3H]-CATR or [3H]-BKA to purified Slc25a4 with appropriate affinity (Kd in the nanomolar range) indicates properly folded protein with intact inhibitor binding sites.

Thermal Shift Assays: Differential scanning fluorimetry using dyes like SYPRO Orange can assess protein stability and the effects of potential ligands. Properly folded Slc25a4 typically shows a cooperative unfolding transition at 40-50°C.

Conformational Analysis: Monitoring the conformational state using 19F-NMR after inserting fluorine-labeled amino acids at key positions (e.g., Y195, Y290) can verify that the protein undergoes proper conformational changes in response to substrates or inhibitors .

Proteoliposome Swelling Assays: This technique measures volume changes in proteoliposomes containing Slc25a4 in response to substrate addition, providing a label-free method to assess transport activity.

A combination of these methods provides comprehensive validation of recombinant Slc25a4 functionality before proceeding to more complex studies.

How is Slc25a4 expression and function altered in various disease states?

Slc25a4 expression and function show significant alterations across multiple disease conditions:

Cancer: SLC25A4 is frequently downregulated in various cancers, including osteosarcoma, where its reduced expression correlates with poor prognosis . This downregulation may contribute to the metabolic reprogramming observed in cancer cells by altering ATP/ADP exchange between mitochondria and cytosol.

Neurodegenerative Diseases: Decreased Slc25a4 function has been linked to neurodegenerative conditions, potentially due to impaired energy metabolism and increased susceptibility to cell death. Conformational changes in Slc25a4 can affect mitochondrial membrane potential and contribute to neuronal vulnerability.

Cardiomyopathy: Mutations in SLC25A4 have been associated with hypertrophic cardiomyopathy and heart failure, reflecting the protein's crucial role in maintaining cardiac energy homeostasis. Heart tissue, with its high energy demands, is particularly sensitive to Slc25a4 dysfunction.

Viral Infections: Viral proteins, such as the Epstein-Barr virus latent membrane protein 1 (EBV-LMP1), can directly interact with Slc25a4 and alter its conformational state, maintaining it in the m-state and preventing mPTP opening . This interaction contributes to increased mitochondrial membrane potential and enhanced cell survival, potentially contributing to viral pathogenesis and therapeutic resistance .

Understanding these disease-specific alterations in Slc25a4 function provides opportunities for targeted therapeutic interventions and biomarker development.

What is the significance of Slc25a4 mutations in disease pathogenesis?

Slc25a4 mutations have profound implications for disease development and progression:

Conformational Changes: Mutations can affect the equilibrium between the m-state and c-state conformations of Slc25a4, altering its transport kinetics and interactions with other mitochondrial proteins. These conformational changes can disrupt normal mitochondrial function, affecting energy production and cellular viability .

Mitochondrial Dynamics: Some Slc25a4 mutations impair its ability to participate in mitochondrial membrane permeability transition, affecting cellular responses to stress and injury. This can lead to either inappropriate cell death or pathological cell survival, depending on the context.

Therapeutic Resistance: In cancer, alterations in Slc25a4 function can contribute to resistance to chemotherapeutic agents. For example, EBV-LMP1-mediated changes in Slc25a4 conformation contribute to cisplatin resistance in nasopharyngeal carcinoma .

Research techniques to study these mutations include site-directed mutagenesis, patient-derived xenografts, and CRISPR-engineered cellular models expressing Slc25a4 variants, allowing for mechanistic studies and therapeutic testing.

How can Slc25a4 conformational states be targeted for therapeutic interventions?

The distinct conformational states of Slc25a4 offer promising targets for therapeutic intervention:

Conformational Inhibitors: Compounds that modulate Slc25a4 conformation, such as CATR (c-state inhibitor) and BKA (m-state inhibitor), can serve as leads for drug development . In cancer therapy, CATR has shown potential by enhancing the chemosensitivity of tumor cells to cisplatin through promoting the c-state conformation of Slc25a4 .

Combination Therapy Approaches: Targeting Slc25a4 conformational states in combination with conventional therapies can enhance treatment efficacy. For example, in EBV-positive cancer cells, combining CATR with cisplatin significantly improved chemotherapy responses by counteracting the effects of viral proteins on Slc25a4 conformation .

Peptide-based Inhibitors: Designed peptides that mimic interaction domains of proteins that naturally bind to Slc25a4 can specifically modulate its conformational states. These peptides could be developed to either promote or inhibit specific protein-protein interactions involving Slc25a4.

Allosteric Modulators: Small molecules that bind to allosteric sites on Slc25a4 could stabilize specific conformational states without completely blocking transport activity, potentially offering more nuanced regulation of mitochondrial function.

Gene Therapy Approaches: For diseases caused by Slc25a4 mutations, gene therapy strategies to restore normal Slc25a4 expression and function could be explored, particularly in tissues with high energy demands like cardiac and skeletal muscle.

Each approach requires careful consideration of tissue specificity and potential off-target effects on other ADP/ATP translocase isoforms to maximize therapeutic efficacy while minimizing adverse effects.

How do viral proteins interact with Slc25a4 and what are the implications for disease mechanisms?

Viral proteins can significantly modulate Slc25a4 function through direct physical interactions:

Localization and Binding: Viral proteins like Epstein-Barr virus latent membrane protein 1 (EBV-LMP1) can localize to the inner mitochondrial membrane where they directly interact with Slc25a4 . This interaction has been confirmed through multiple experimental approaches including co-immunoprecipitation, confocal microscopy showing co-localization, and in vitro binding assays .

Interaction Domains: The transmembrane region of EBV-LMP1 is essential for its binding to Slc25a4, as demonstrated by studies using truncated versions of LMP1 . Similarly, domain 2 of Slc25a4 appears critical for the interaction with viral proteins, as only Slc25a4 constructs retaining this domain maintain binding capability .

Conformational Effects: EBV-LMP1 binding to Slc25a4 locks the transporter in the m-state conformation, inhibiting its conformational cycling . This conformational locking prevents the formation of the ANT1-VDAC1 complex, which is necessary for mitochondrial permeability transition pore (mPTP) opening .

Functional Consequences: By maintaining Slc25a4 in the m-state, viral proteins like EBV-LMP1 increase mitochondrial membrane potential and promote cell survival, potentially contributing to viral persistence and therapeutic resistance in infected cells . This mechanism may represent a common strategy used by different viruses to manipulate host cell energetics and survival pathways.

These findings highlight the importance of considering viral interactions when studying Slc25a4 in pathological contexts and suggest potential antiviral strategies targeting these specific protein-protein interactions.

What advanced techniques can be used to study protein-protein interactions involving Slc25a4?

Researchers can employ several cutting-edge techniques to investigate Slc25a4 interactions:

Proximity-Based Labeling: Techniques like BioID or APEX2, where Slc25a4 is fused to a biotin ligase or peroxidase, can identify proteins in close proximity to Slc25a4 in living cells. This approach is particularly valuable for detecting transient or weak interactions within the mitochondrial membrane environment.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This method can map protein interaction surfaces by measuring changes in hydrogen-deuterium exchange rates when Slc25a4 binds to partner proteins. It provides structural insights without requiring protein crystallization.

Single-Molecule FRET: By labeling Slc25a4 and potential interaction partners with appropriate fluorophores, single-molecule FRET can detect interactions and conformational changes in real-time, even in membrane environments.

Cryo-Electron Microscopy: Recent advances in cryo-EM technology allow visualization of membrane protein complexes at near-atomic resolution, potentially revealing the structural basis of Slc25a4 interactions with proteins like VDAC1 or viral proteins .

Genetic Code Expansion and Cross-linking: Incorporation of unnatural amino acids with photo-crosslinking capabilities at specific positions in Slc25a4 can capture transient interactions when activated by light, allowing identification of binding partners at specific sites .

Förster Resonance Energy Transfer (FRET): FRET-based biosensors can monitor Slc25a4 interactions in living cells, providing spatial and temporal information about dynamic protein complexes.

These complementary approaches can provide comprehensive insights into the complex interaction network of Slc25a4 in both physiological and pathological contexts.

What are the emerging applications of recombinant Slc25a4 in biotechnology and drug discovery?

Recombinant Slc25a4 is finding increasing applications in multiple research areas:

High-Throughput Drug Screening: Purified recombinant Slc25a4 can be used in biochemical or liposome-based assays to screen compound libraries for molecules that modulate its transport activity or conformational states. This approach has potential for identifying novel therapeutics for conditions ranging from cancer to mitochondrial disorders.

Biosensor Development: Engineered versions of Slc25a4 incorporating fluorescent proteins or environmentally sensitive dyes can serve as biosensors for mitochondrial energy status or membrane potential in living cells. These tools could advance our understanding of mitochondrial biology and disease mechanisms.

Structural Biology Platforms: Recombinant Slc25a4 provides material for structural studies using X-ray crystallography, cryo-EM, or NMR spectroscopy, contributing to structure-based drug design targeting this important protein. The ability to produce protein with specific mutations or modifications enhances these structural biology applications .

Protein-Protein Interaction Analysis: Immobilized recombinant Slc25a4 can be used in pull-down assays or surface plasmon resonance studies to identify and characterize novel interaction partners, potentially revealing new regulatory mechanisms or therapeutic targets.

Nanoparticle-Based Delivery Systems: Recombinant Slc25a4 incorporated into liposomes or nanoparticles could potentially be used to target therapeutic agents to mitochondria, addressing the challenge of mitochondrial drug delivery.

These applications highlight the versatility of recombinant Slc25a4 as both a research tool and a platform for therapeutic development targeting mitochondrial energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.