Recombinant Mouse ADP/ATP translocase 4 (Slc25a31)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biochemical Properties

ANT4 facilitates mitochondrial ATP synthesis and regulates apoptosis by stabilizing membrane potential. Key findings include:

Transport Kinetics

Functional studies in yeast models (human ANT4 homolog) reveal:

  • ATP/ADP exchange: Similar kinetics to somatic isoforms (ANT1-3) but requires lipid interaction for optimal activity .

  • Regulation: Phospholipid-binding mutations improve yeast complementation, suggesting membrane adaptation in germ cells .

Apoptotic Regulation

  • Anti-apoptotic function: Inhibits chromatin fragmentation and mitochondrial permeability transition pore (PTP) opening .

  • ATP Import: Critical for sperm survival, compensating for the absence of ANT2 in germ cells .

Recombinant Protein Production and Applications

While direct data on recombinant mouse ANT4 is sparse, methodologies from human studies provide a framework:

AspectDetailsSource
Expression SystemsE. coli (His-tagged) or yeast for functional assays (e.g., ATP/ADP exchange)
PurificationAffinity chromatography (His-tag) or reconstitution into liposomes
Quality ControlSDS-PAGE (>90% purity), mass spectrometry for sequence validation

Potential Applications:

  • Spermatogenesis Studies: Investigating ATP dynamics during meiosis.

  • Cancer Research: Overexpression of ANT4 in cancer cells may confer resistance to apoptosis-inducing drugs .

  • Mitochondrial Pathology: Examining interactions with OPA1 or post-translational modifications (e.g., ADP-ribosylation) .

Murine Models

  • Infertility: Slc25a31-deficient mice exhibit spermatogenesis failure due to mitochondrial ATP depletion .

  • Apoptosis: ANT4 knockout increases germ cell apoptosis, highlighting its role in survival signaling .

Human and Cross-Species Insights

  • Disease Association: No human mutations linked to SLC25A31, but overexpression in cancer cells may protect against drug-induced apoptosis .

  • Post-Translational Modifications: ADP-ribosylation by bacterial effectors (e.g., Legionella Lpg0080) modulates mitochondrial ATP transport .

Comparative Analysis of ANT Isoforms

IsoformTissue ExpressionFunctionUnique FeaturesSource
ANT1UbiquitousATP/ADP exchange, oxidative stressHigh expression in heart/liver
ANT2Somatic tissuesEnergy metabolism, apoptosisX-chromosome localization
ANT3UbiquitousMitochondrial membrane potentialRedox-sensitive regulation
ANT4Male germ cellsSperm ATP import, apoptosis inhibitionExtended N-/C-terminals, lipid interaction

Challenges and Future Directions

  • Structural Limitations: N-/C-terminal extensions may hinder crystallization for high-resolution studies.

  • Therapeutic Potential: Targeting ANT4 in spermatogenesis disorders or cancer requires isoform-specific inhibitors.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that tag type.
Synonyms
Slc25a31; Aac4; Ant4; Sfec; ADP/ATP translocase 4; ADP,ATP carrier protein 4; Adenine nucleotide translocator 4; ANT 4; Solute carrier family 25 member 31; Sperm flagellar energy carrier protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSNESSKKQSSKKALFDPVSFSKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISP EARYKGMLDCLVRIPREQGFLSYWRGNLANVIRYFPTQALNFAFKDKYKELFMSGVNKEK QFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGVDIGKGPEQRQFTGLGDCIMKIAKS DGLIGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLVSFIIAQIVTTCSGIL SYPFDTVRRRMMMQSGESDRQYKGTIDCFLKIYRHEGVPAFFRGAFSNILRGTGGALVLV LYDKIKEFLNIDVGGSSSGD
Uniprot No.

Target Background

Function
ADP:ATP antiporter, SLC25A31/ANT4, mediates the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel cellular processes. It alternates between a cytoplasmic-open state (c-state) and a matrix-open state (m-state), operating through the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane. This protein is particularly crucial during spermatogenesis, likely mediating ADP:ATP exchange in spermatocytes. Adequate ATP supply from mitochondria is critical for normal spermatogenesis progression during early stages of meiotic prophase I, including DNA double-strand break repair and chromosomal synapsis.
Beyond its ADP:ATP antiporter activity, SLC25A31/ANT4 is also involved in mitochondrial uncoupling and mitochondrial permeability transition pore (mPTP) activity. It contributes to mitochondrial uncoupling by acting as a proton transporter, uncoupling the proton flows via the electron transport chain and ATP synthase. This reduces the efficiency of ATP production and induces mitochondrial thermogenesis. Proton transporter activity is inhibited by ADP:ATP antiporter activity, suggesting that SLC25A31/ANT4 acts as a central regulator of mitochondrial energy output, maintaining a delicate balance between ATP production (ADP:ATP antiporter activity) and thermogenesis (proton transporter activity). Proton transporter activity requires free fatty acids as a cofactor but does not transport them.
SLC25A31/ANT4 also plays a pivotal role in mPTP opening, a non-specific pore that allows free passage of solutes up to 1.5 kDa across the mitochondrial membranes. This contributes to cell death. However, it remains unclear whether SLC25A31/ANT4 forms part of the mPTP structure or simply regulates its function.
Gene References Into Functions
  1. Ant4 is a meiosis-specific gene expressed during both male and female gametogenesis, though it is indispensable only during spermatogenesis and not oogenesis. PMID: 25031318
  2. Studies indicate that Ant4 expression is selective to the testis and sperm in adult mammals and is indeed essential for mouse spermatogenesis. PMID: 21858006
  3. Adenine nucleotide translocase 4 deficiency leads to early meiotic arrest of murine male germ cells. PMID: 19556438
  4. Adenine nucleotide translocase 4 is essential for spermatogenesis. PMID: 17681941
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Cell projection, cilium, flagellum membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in undifferentiated embryonic stem cells and germ cells. Expression is down-regulated after embryonic stem cells differentiation. In adults, only expressed in developing gametes in testis. In testis, expressed at higher level in spe

Q&A

What is the molecular structure of mouse Slc25a31 and how does it compare to human orthologues?

Mouse Slc25a31, like its human ortholog, contains six transmembrane helices that form a homodimer functional unit serving as an ADP/ATP channel protein. The protein features distinctive amino acid sequences at both N- and C-terminals that differentiate it from other ANT isoforms. These terminal regions likely facilitate specialized functions, particularly localization to sperm flagella. When designing expression constructs, researchers should consider preserving these terminal regions to maintain proper protein folding and functionality .

The gene structure consists of 6 exons spanning approximately 44 kbp of DNA, similar to the human gene organization. For recombinant expression, codon optimization may improve yields, but researchers should verify that modifications do not disrupt critical structural elements.

What are the primary functional mechanisms of Slc25a31 at the molecular level?

Slc25a31 functions primarily as a mitochondrial ADP/ATP carrier that catalyzes the exchange of ADP and ATP between the mitochondrial matrix and cytoplasm during ATP synthesis. Its mechanism involves:

  • Stabilization of mitochondrial membrane potential

  • Regulation of permeability transition pore complex (PTPC) opening

  • Prevention of nuclear chromatin fragmentation and subsequent cell death

  • ATP import into mitochondria, particularly in sperm cells

To accurately assess recombinant Slc25a31 functionality, researchers should implement ATP/ADP exchange assays using reconstituted liposomes or isolated mitochondria. Mutation of key residues in the transmembrane domains can provide valuable insights into structure-function relationships.

What is the tissue-specific expression pattern of Slc25a31 in mice?

In mice, Slc25a31 shows a highly tissue-specific expression pattern. While low expression levels are detected in liver and brain tissues, adult males exhibit predominant expression in the testis . This restricted expression profile correlates with its specialized function in spermatogenesis.

When designing experimental controls for recombinant protein studies, researchers should consider:

  • Using testicular tissue as positive control for expression validation

  • Comparing expression levels with other ANT isoforms (ANT1-3) that show different tissue distribution patterns

  • Accounting for potential developmental stage-specific expression differences

How is Slc25a31 expression regulated during spermatogenesis?

Slc25a31 expression is tightly regulated during spermatogenesis, with increased expression coinciding with specific developmental stages of sperm maturation. Studies on ANT4-deficient mice reveal that loss of this protein leads to increased apoptosis in testicular tissue and subsequent infertility, indicating its essential role in spermatogenesis .

To investigate regulatory mechanisms in recombinant systems, researchers should:

  • Design reporter constructs containing the endogenous promoter region

  • Analyze epigenetic modifications that may influence expression

  • Investigate potential transcription factors that bind to regulatory regions

  • Consider the role of post-transcriptional regulation through microRNAs

What are the optimal expression systems for producing functional recombinant mouse Slc25a31?

For successful expression of functional recombinant mouse Slc25a31, researchers should consider:

  • Mammalian expression systems (HEK293, CHO cells) to ensure proper folding and post-translational modifications

  • Baculovirus-insect cell systems for higher yield while maintaining eukaryotic processing

  • Cell-free systems for rapid screening of functional variants

When using bacterial expression systems (E. coli), consider:

  • Using specialized strains designed for membrane protein expression

  • Incorporation of solubility tags (MBP, SUMO) to improve folding

  • Expression at lower temperatures (16-18°C) to reduce inclusion body formation

  • Addition of specific lipids during purification to maintain native conformation

What analytical techniques are most effective for characterizing recombinant Slc25a31 activity?

To effectively characterize recombinant Slc25a31 activity, researchers should employ multiple complementary approaches:

  • ATP/ADP Exchange Assays: Measure the rate of nucleotide exchange using radiolabeled substrates or fluorescent ATP analogues in reconstituted systems.

  • Membrane Potential Analysis: Assess the protein's ability to maintain membrane potential using potential-sensitive dyes in mitochondria or proteoliposomes.

  • Binding Affinity Measurements: Determine substrate binding constants using isothermal titration calorimetry or surface plasmon resonance.

  • Structural Analysis: Utilize circular dichroism and thermal shift assays to confirm proper folding of the recombinant protein.

  • Functional Complementation: Test the ability of recombinant Slc25a31 to rescue phenotypes in Ant4-deficient cell models .

How does Slc25a31 differ functionally from other ADP/ATP translocase family members?

Unlike other ANT isoforms, Slc25a31 (ANT4) is specifically required for spermatogenesis. While ANT2 carries out ATP import into mitochondria in most cells, spermatogenic cells specifically require ANT4 for this function . This functional specialization is likely related to the unique energy demands during sperm development and maturation.

Experimental approaches to investigate functional differences include:

  • Comparative analysis of ATP/ADP exchange kinetics between different ANT isoforms

  • Domain swapping experiments to identify regions responsible for functional specialization

  • Cell-specific rescue experiments in knockout models

  • Investigation of differential protein interactions using proximity labeling or co-immunoprecipitation

How does Slc25a31 contribute to mitochondrial homeostasis during cellular stress?

Slc25a31 plays a crucial role in maintaining mitochondrial homeostasis during cellular stress by:

  • Stabilizing mitochondrial membrane potential

  • Decreasing permeability transition pore complex (PTPC) opening

  • Preventing nuclear chromatin fragmentation and cell death

To investigate these functions in experimental settings, researchers can:

  • Expose recombinant Slc25a31-expressing cells to various stressors (oxidative stress, calcium overload)

  • Measure mitochondrial parameters (membrane potential, ROS production, calcium flux)

  • Assess cell survival and apoptotic markers

  • Compare responses between wild-type and mutant variants of the protein

What structural features should be preserved when designing Slc25a31 fusion proteins?

When designing fusion proteins containing Slc25a31, researchers should consider:

  • Preserving the integrity of transmembrane domains that form the channel

  • Maintaining the unique N- and C-terminal regions that are longer than in other ANT isoforms

  • Ensuring proper orientation of the protein in the membrane

  • Considering flexible linker regions between Slc25a31 and fusion partners

A methodological approach includes:

  • In silico structural modeling to predict optimal fusion points

  • Systematic testing of different linker lengths and compositions

  • Verification of proper membrane insertion and topology

  • Functional validation using ATP/ADP exchange assays

How can researchers optimize solubility and stability of recombinant Slc25a31?

As a transmembrane protein, Slc25a31 presents challenges for solubility and stability in recombinant systems. Optimization strategies include:

  • Detergent Screening: Systematic testing of different detergent classes (maltoside, glucoside, fos-choline) at varying concentrations to identify optimal solubilization conditions.

  • Lipid Supplementation: Addition of specific lipids (cardiolipin, phosphatidylcholine) during purification to stabilize the native conformation.

  • Buffer Optimization: Testing various pH conditions, salt concentrations, and additives (glycerol, amino acids) to enhance stability.

  • Thermostability Improvements: Introduction of disulfide bonds or thermostabilizing mutations based on structural analysis and evolutionary conservation.

How do mouse models of Slc25a31 deficiency inform our understanding of human fertility disorders?

Studies on Ant4-deficient mice have demonstrated increased apoptosis in testicular tissue leading to infertility . These findings provide valuable insights into potential mechanisms underlying certain forms of human male infertility.

Research approaches to translate findings between mouse models and human conditions include:

  • Comparative analysis of expression patterns in human and mouse reproductive tissues

  • Functional assessment of Slc25a31 variants identified in infertile men

  • Generation of knock-in mouse models expressing human variants

  • Investigation of compensatory mechanisms in different species

What is the relationship between Slc25a31 and mitochondrial diseases?

While the SLC25A31 gene has not been directly implicated in human mitochondrial diseases outside of reproductive contexts, understanding its role in mitochondrial homeostasis provides valuable insights into energy metabolism disorders .

Researchers investigating potential connections should consider:

  • Examining Slc25a31 expression in tissues affected by mitochondrial disorders

  • Investigating potential compensatory upregulation in response to dysfunction of other SLC25 family members

  • Analyzing mitochondrial function in tissues with altered Slc25a31 expression

  • Screening for Slc25a31 variants in patients with unexplained mitochondrial dysfunction

What emerging technologies show promise for advancing Slc25a31 research?

Several cutting-edge technologies offer new opportunities for Slc25a31 research:

  • Cryo-EM Analysis: High-resolution structural determination of Slc25a31 in different conformational states to elucidate transport mechanism.

  • Single-Molecule Transport Assays: Direct visualization of ATP/ADP exchange in reconstituted systems.

  • CRISPR-Based Approaches: Precise genome editing to introduce tagged versions of Slc25a31 at endogenous loci.

  • Advanced Imaging Techniques: Super-resolution microscopy to visualize Slc25a31 localization and dynamics in mitochondria.

  • Systems Biology Integration: Multi-omics analysis to understand Slc25a31 function in the context of broader metabolic networks.

How might understanding Slc25a31 function contribute to reproductive medicine advances?

Insights into Slc25a31 function could lead to several applications in reproductive medicine:

  • Development of diagnostic markers for specific forms of male infertility

  • Identification of therapeutic targets for enhancing sperm mitochondrial function

  • Creation of in vitro assays to assess sperm energetic capacity

  • Design of targeted approaches to protect sperm mitochondria during cryopreservation

Methodological approaches should focus on translational research that connects fundamental mechanisms to clinical applications while respecting ethical considerations in reproductive medicine research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.