Recombinant Mouse Alkaline ceramidase 1 (Acer1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Acer1; Asah3; Alkaline ceramidase 1; AlkCDase 1; Alkaline CDase 1; maCER1; Acylsphingosine deacylase 3; N-acylsphingosine amidohydrolase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Acer1
Target Protein Sequence
MHVPGTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPY AQKRTRCFYGVSVLFMLIGLFSMYFHMTLSFLGQLLDEISILWLLASGYSVWLPRCYFPK FVKGNRFYFSCLVTITTIISTFLTFVKPTVNAYALNSIAIHILYIVRTEYKKIRDDDLRH LIAVSVVLWAAALTSWISDRVLCSFWQRIHFYYLHSIWHVLISITFPYGIVTMALVDAKY EMPDKTLKVHYWPRDSWVIGLPYVEIQENDKNC
Uniprot No.

Target Background

Function
Alkaline ceramidase 1 (Acer1) is an endoplasmic reticulum enzyme that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids under alkaline pH conditions. Ceramides, sphingosine, and its phosphorylated form, sphingosine-1-phosphate, are bioactive lipids involved in cellular signaling pathways that regulate various biological processes, including cell proliferation, apoptosis, and differentiation. Acer1 exhibits a strong substrate specificity towards the natural stereoisomer of ceramides with D-erythro-sphingosine as a backbone, demonstrating higher activity towards very long-chain unsaturated fatty acids like C24:1-ceramide. It may also hydrolyze dihydroceramides to produce dihydrosphingosine. Acer1 is a skin-specific ceramidase that regulates the levels of ceramides, sphingosine, and sphingosine-1-phosphate in the epidermis, mediating the calcium-induced differentiation of epidermal keratinocytes and playing a crucial role in skin homeostasis.
Gene References Into Functions
  1. Acer1 deficiency resulted in elevated levels of various ceramides and sphingoid bases in the skin, leading to progressive hair loss in mice. PMID: 29056331
  2. Our research revealed ceramidase as a crucial player in sphingosine-induced platelet activation following GPVI-dependent signaling. PMID: 29395079
  3. Acer1 is a novel alkaline ceramidase with stringent substrate specificity and is selectively expressed in skin. It may play a role in regulating the levels of bioactive lipids ceramide and sphingosine-1-phosphate, as well as complex sphingolipids. PMID: 12783875
Database Links
Protein Families
Alkaline ceramidase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in skin. Weakly or not expressed in other tissues. Expressed by granular layer of interfollicular epidermis, sebaceous glands and infundibulum.

Q&A

What is Alkaline Ceramidase 1 (Acer1) and what is its primary function in mice?

Alkaline Ceramidase 1 (Acer1) is an enzyme that plays a key role in ceramide metabolism in the epidermis and its appendages. Its primary function is regulating the homeostasis of ceramides and their metabolites in the skin . Acer1 exhibits strong hydrolase activity against very-long-chain (VLC) ceramides and moderate activity against long-chain (LC) ceramides, catalyzing their conversion to sphingosine and free fatty acids . This enzymatic activity is essential for maintaining proper ceramide levels in the epidermis, which in turn affects cellular processes including proliferation, differentiation, and apoptosis .

How does Acer1 expression differ across mouse tissues?

Acer1 expression shows distinct tissue specificity with highest expression in skin tissues, particularly in the epidermis. While tail skin demonstrates strong Acer1 expression, other tissues such as adipose tissue show minimal expression levels . Within the skin, Acer1 is predominantly expressed in the interfollicular epidermis (IFE), hair follicles (HF), and sebaceous glands (SG), suggesting its importance in all major compartments of the epidermal system . This tissue-specific expression pattern correlates with the observed phenotypic effects of Acer1 deficiency, which primarily manifest as skin and hair abnormalities.

What phenotypes are observed in Acer1-deficient mice?

Acer1-deficient mice (Acer1−/−) display several distinctive phenotypes:

  • Progressive hair loss beginning around 4 weeks of age

  • Cyclical pattern of hair loss followed by regrowth

  • Disrupted hair follicle formation with abnormal arrangement of hair follicle triplet clusters

  • Altered hair follicle cycling, with accelerated entry into anagen phase

  • Increased thickness of the cornified layer of the epidermis

  • Abnormal organization of the granular-transitional cell layer junctional area

  • Differences in sizes of keratohyalin granules in the granular layer

  • Lower body weight at middle ages (13-18 months) compared to wild-type mice

These phenotypic changes indicate that Acer1 is essential for normal epidermal development and hair follicle cycling in mice.

How does Acer1 deficiency affect ceramide metabolism in mouse skin?

Acer1 deficiency leads to complex alterations in ceramide metabolism beyond simple accumulation of substrates. In Acer1−/− mice, the following biochemical changes are observed:

Sphingolipid ClassSpecies AffectedChange in Acer1−/− vs. Wild Type
CeramidesC16:0, C20:0, C22:0, C24:0, C26:0Increased
CeramidesC24:1, C26:1 (unsaturated VLCs)No change
DihydroceramidesAll speciesNo change
PhytoceramidesVarious speciesSubstantially increased
α-hydroxyceramidesVarious speciesSubstantially increased
MonohexosylceramidesAll speciesNo change
SphingomyelinsAll speciesNo change

Interestingly, loss of Acer1 not only affects ceramide levels but also impacts the expression of other sphingolipid metabolism enzymes. Acer1 deficiency increases mRNA levels of Acer2, Acer3, and S1P phosphatase 2 (Sgpp2) while decreasing expression of acid ceramidase (Asah1), neutral ceramidase (Asah2), sphingosine kinase 1 (Sphk1), and sphingosine kinase 2 (Sphk2) . This compensatory gene expression response likely contributes to the complex sphingolipid profile observed in Acer1−/− mice.

What molecular mechanisms link Acer1 function to hair follicle stem cell (HFSC) maintenance?

Acer1 regulates HFSC maintenance through several interconnected molecular mechanisms:

  • Sphingolipid-mediated signaling: Different ceramide species exert opposing effects on cellular functions. Very-long-chain ceramides (C24 and C24:1) promote cell proliferation and survival, while long-chain ceramides (C16 and C18) inhibit proliferation and induce apoptosis . By regulating the balance between these ceramide species, Acer1 modulates HFSC proliferation and survival.

  • Sphingosine (SPH) regulation: Acer1 deficiency alters SPH levels, which influences cell proliferation, differentiation, and apoptosis . SPH has been shown to inhibit cell proliferation and induce differentiation or apoptosis in various cell types.

  • Cell proliferation control: Immunohistochemistry reveals that Acer1−/− mice have fewer Ki-67-positive (proliferating) cells in the interfollicular epidermis basal layer, hair follicles, and sebaceous glands compared to wild-type mice .

  • Differentiation regulation: Acer1 deficiency affects expression of differentiation markers, with decreased expression of PCNA (proliferation marker), cytokeratin 14 (K14, basal layer marker), and FAS (sebaceous gland marker) and increased expression of K10 and involucrin (differentiation markers) .

These mechanisms collectively contribute to the progressive loss of HFSCs observed in Acer1-deficient mice, ultimately leading to hair loss.

How does Acer1 deficiency impact epidermal barrier function and ultrastructure?

Acer1 deficiency causes significant changes in epidermal ultrastructure that may impact barrier function:

  • Cornified layer thickening: Acer1−/− mice exhibit a substantial increase in the thickness of the cornified layer of the epidermis, suggesting altered terminal differentiation of keratinocytes .

  • Granular-transitional layer disruption: Electron microscopy reveals abnormal organization of the granular-transitional cell layer junctional area in Acer1−/− epidermis .

  • Keratohyalin granule alterations: Differences in the sizes of keratohyalin granules in the granular layer are observed in Acer1−/− mice compared to wild-type animals .

  • Layer marker expression changes: While basal (K14) and granular (filaggrin) layer markers show no obvious changes, the cornified layer exhibits significant structural differences in Acer1-deficient mice .

These ultrastructural changes suggest that Acer1 plays a role in proper epidermal stratification and barrier formation, potentially through regulating ceramide-dependent processes involved in keratinocyte differentiation and cornified envelope formation.

What are the optimal methods for generating and validating Acer1-deficient mouse models?

When generating and validating Acer1-deficient mouse models, researchers should consider the following methodological approaches:

  • Gene targeting strategies:

    • Conventional knockout: Complete deletion of the Acer1 gene is effective for studying its functions in skin homeostasis .

    • Conditional knockout: For tissue-specific or inducible deletion, Cre-loxP systems can be employed using skin-specific promoters (K14-Cre or K5-Cre).

    • CRISPR/Cas9: For more rapid generation of mutant models with specific modifications.

  • Genotyping validation:

    • PCR-based methods using primers spanning the deleted region

    • Southern blot analysis to confirm correct targeting

    • Sequencing to verify exact modifications

  • Expression validation:

    • RT-qPCR to confirm absence of Acer1 mRNA

    • Western blotting to verify protein absence

    • Enzymatic activity assays using ceramide substrates to confirm loss of function

  • Phenotypic characterization:

    • Histological analysis using H&E staining of skin sections

    • Hair cycle monitoring through periodic imaging and hair regrowth assessments

    • Immunohistochemistry for proliferation (Ki-67, PCNA) and differentiation markers (K14, K10, involucrin, filaggrin, loricrin)

    • Transmission electron microscopy (TEM) to examine ultrastructural features

  • Controls:

    • Use of littermate controls (Acer1+/+ and Acer1+/−) to minimize background effects

    • Age and sex matching for all comparisons

    • Analysis at multiple time points (e.g., 6, 10, 16, and 28 weeks) to track progression of phenotypes

This comprehensive approach ensures robust validation of the model and reliable characterization of Acer1 function.

What are the recommended protocols for measuring Acer1 enzymatic activity in tissue samples?

To accurately measure Acer1 enzymatic activity in tissue samples, researchers should follow these methodological steps:

  • Tissue preparation:

    • Harvest fresh tissue samples and immediately snap-freeze in liquid nitrogen

    • Prepare tissue homogenates in appropriate buffer systems maintaining neutral to slightly alkaline pH (pH 7.4-9.0)

    • Isolate subcellular fractions (microsomal preparations) for enrichment of membrane-bound Acer1

  • Substrate preparation:

    • Use both long-chain (LC) and very-long-chain (VLC) ceramides as substrates

    • C18:1-ceramide serves as an effective substrate for assessing LC ceramidase activity

    • NBD-labeled ceramides may be used for fluorescence-based detection

    • Radiolabeled ceramides provide increased sensitivity for quantitative measurements

  • Assay conditions:

    • Conduct reactions at alkaline pH (8.5-9.5) to ensure optimal Acer1 activity

    • Include appropriate controls: heat-inactivated samples and samples from Acer1−/− tissues

    • Determine linearity range for both time and protein concentration

  • Product detection and quantification:

    • HPLC or LC-MS/MS analysis for precise quantification of sphingosine and fatty acid products

    • Thin-layer chromatography (TLC) with fluorescence or radiometric detection

    • Enzymatic coupling reactions for colorimetric/fluorometric detection

  • Data analysis:

    • Calculate specific activity as nmol product formed per mg protein per hour

    • Compare substrate specificity profiles between wild-type and Acer1-deficient samples

    • Normalize to appropriate housekeeping enzymes or proteins

Following this protocol ensures reliable measurement of Acer1 activity and enables discrimination between Acer1 and other ceramidases present in tissue samples.

What are the best techniques for sphingolipid profiling in Acer1 research?

Comprehensive sphingolipid profiling in Acer1 research requires sophisticated analytical approaches:

  • Sample preparation:

    • Perform lipid extraction using modified Bligh and Dyer method or solid-phase extraction

    • Separate sphingolipid classes using silica column chromatography

    • Consider subcellular fractionation for compartment-specific analysis

  • Analytical platforms:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS): Gold standard for comprehensive sphingolipid analysis

    • High-resolution mass spectrometry for detailed structural characterization

    • Multiple reaction monitoring (MRM) for targeted quantification of specific sphingolipid species

  • Specific sphingolipid classes to analyze:

    • Ceramides (saturated, unsaturated, hydroxylated species)

    • Dihydroceramides

    • Phytoceramides

    • α-hydroxyceramides

    • Monohexosylceramides

    • Sphingomyelins

    • Free sphingoid bases (sphingosine, sphinganine, phytosphingosine)

    • Phosphorylated sphingoid bases (S1P, dihydro-S1P)

  • Quantification and standardization:

    • Use internal standards for each sphingolipid class

    • Include both labeled and unlabeled standards for matrix effect correction

    • Employ external calibration curves for absolute quantification

  • Data analysis and visualization:

    • Heat maps for comparing sphingolipid profiles across genotypes

    • Principal component analysis to identify key differences

    • Pathway analysis to correlate sphingolipid changes with biological effects

This approach has been successfully used to demonstrate that Acer1 deficiency increases levels of ceramides carrying saturated LC or VLC (C16:0, C20:0, C22:0, C24:0, and C26:0), phytoceramides, and α-hydroxyceramides in mouse skin without affecting complex sphingolipids like monohexosylceramides or sphingomyelins .

How should researchers interpret contradictory results between ceramide levels and hair loss phenotypes?

When faced with contradictory results between ceramide levels and hair loss phenotypes in Acer1 research, researchers should consider several methodological and biological factors:

  • Ceramide species-specific effects:

    • Different ceramide species have opposing biological functions - VLC ceramides (C24, C24:1) promote cell proliferation and survival, while LC ceramides (C16, C18) inhibit proliferation and induce apoptosis

    • Analyze ratios between different ceramide species rather than total ceramide levels

    • Examine compartment-specific ceramide distributions, as localization may be as important as total levels

  • Compensatory mechanisms:

    • Evaluate expression of other ceramidases (Acer2, Acer3, Asah1, Asah2) that may partially compensate for Acer1 deficiency

    • Assess adaptive changes in sphingolipid metabolic enzymes that may mitigate primary defects

    • Consider temporal changes in compensation (early vs. late adaptation)

  • Hair cycle synchronization issues:

    • Control for hair cycle stage when measuring ceramide levels, as normal cycling causes natural fluctuations

    • Use hair cycle synchronization techniques (e.g., depilation) to establish common baselines

    • Track ceramide changes longitudinally through complete hair cycles

  • Strain background effects:

    • C57BL/6J background may show different phenotypic manifestations than other strains

    • Consider using multiple genetic backgrounds to distinguish strain-specific from Acer1-specific effects

    • Implement backcrossing to ensure genetic homogeneity

  • Age-dependent phenotypes:

    • Perform time-course analyses as Acer1−/− mice show age-dependent phenotypes

    • Compare young (1-7 months) versus middle-aged (13-18 months) mice for both ceramide profiles and hair phenotypes

    • Consider developmental versus maintenance roles of Acer1

By systematically addressing these factors, researchers can resolve apparent contradictions and develop more nuanced models of how Acer1 regulates hair follicle homeostasis through ceramide metabolism.

What statistical approaches are most appropriate for analyzing sphingolipid changes in Acer1-deficient models?

Appropriate statistical analysis of sphingolipid changes in Acer1-deficient models requires careful consideration of data characteristics:

  • Experimental design considerations:

    • Calculate sample sizes based on power analysis (minimum n=3-5 per group as used in published studies)

    • Include biological replicates (different animals) and technical replicates

    • Control for confounding variables: age, sex, hair cycle stage, and housing conditions

  • Univariate analysis for individual sphingolipid species:

    • Student's t-test for comparing two groups (wild-type vs. Acer1−/−) when data is normally distributed

    • Mann-Whitney U test for non-parametric comparisons

    • One-way ANOVA with post-hoc tests (Tukey, Bonferroni) for multiple group comparisons (e.g., Acer1+/+, Acer1+/−, Acer1−/−)

    • Repeated measures ANOVA for time-course experiments

  • Multivariate analysis for sphingolipid profiles:

    • Principal Component Analysis (PCA) to identify patterns in sphingolipid profiles

    • Partial Least Squares-Discriminant Analysis (PLS-DA) for classification and biomarker identification

    • Hierarchical clustering to identify co-regulated sphingolipid species

    • ANOVA-simultaneous component analysis (ASCA) for multi-factor experimental designs

  • Correlation analysis:

    • Pearson or Spearman correlation between sphingolipid levels and phenotypic measures

    • Network analysis to map relationships between different sphingolipid species

    • Regression models to predict phenotypic outcomes from sphingolipid profiles

  • Multiple testing correction:

    • Apply False Discovery Rate (FDR) correction for large-scale lipidomic data

    • Benjamini-Hochberg procedure for controlling false positives

    • Consider pathway-level statistics to increase power

These statistical approaches have successfully revealed significant increases in various ceramide species in Acer1−/− mouse skin while demonstrating no changes in other sphingolipid classes , providing robust evidence for Acer1's role in ceramide metabolism.

How can researchers distinguish primary effects of Acer1 deficiency from secondary compensatory responses?

Distinguishing primary from secondary effects in Acer1-deficient models requires sophisticated experimental approaches:

  • Temporal analysis strategies:

    • Conduct time-course experiments beginning before phenotype onset

    • Use inducible knockout systems to observe immediate effects of Acer1 deletion

    • Compare acute versus chronic responses to identify adaptation mechanisms

  • Molecular profiling approaches:

    • Transcriptomic analysis to identify early gene expression changes

    • Proteomics to detect altered protein levels and post-translational modifications

    • Metabolomics focusing on sphingolipid pathway intermediates and related metabolites

  • Pathway inhibition studies:

    • Pharmacologically inhibit compensatory enzymes (e.g., Acer2, Acer3)

    • Generate compound mutants (e.g., Acer1/Acer2 double knockout)

    • Use pathway-specific inhibitors to block secondary responses

  • Cell-specific analyses:

    • Perform single-cell RNA sequencing to identify cell populations with primary responses

    • Use laser capture microdissection to isolate specific epidermal compartments

    • Conduct in situ hybridization or immunohistochemistry to localize expression changes

  • Rescue experiments:

    • Express wild-type Acer1 in knockout background to confirm reversibility of effects

    • Use catalytically inactive Acer1 mutants to distinguish enzymatic from structural roles

    • Perform metabolite supplementation to bypass metabolic blocks

Evidence from existing studies suggests that primary effects of Acer1 deficiency include immediate ceramide accumulation, while secondary compensatory responses involve altered expression of sphingolipid metabolism genes such as Acer2, Acer3, Sgpp2, Asah1, Asah2, Sphk1, and Sphk2 . This adaptive response likely explains why Acer1 deficiency unexpectedly increases rather than decreases some of its enzymatic products.

What are the most promising applications of recombinant Acer1 in skin disease research?

Recombinant Acer1 holds significant potential for advancing skin disease research in several key areas:

  • Therapeutic development for hyperkeratotic disorders:

    • Exploring recombinant Acer1 as a potential biological therapeutic for conditions characterized by excessive cornification

    • Investigating topical application of recombinant Acer1 to normalize ceramide profiles in hyperkeratotic skin disorders

    • Developing ceramidase-based approaches for treating disorders with abnormal epidermal barrier function

  • Hair loss disorders:

    • Using recombinant Acer1 to modulate ceramide profiles in hair follicles for potential treatment of alopecia

    • Exploring the role of Acer1 in human androgenetic alopecia and alopecia areata

    • Investigating whether Acer1 supplementation can rescue hair follicle stem cell function in aging or disease

  • Wound healing applications:

    • Examining how Acer1-mediated ceramide metabolism affects re-epithelialization

    • Developing Acer1-based interventions to promote proper barrier formation during wound healing

    • Investigating Acer1's role in abnormal scarring conditions

  • Skin inflammation research:

    • Exploring connections between Acer1 activity and inflammatory skin conditions

    • Using recombinant Acer1 to modulate sphingolipid-mediated inflammatory signaling

    • Investigating potential anti-inflammatory effects of targeted ceramide metabolism

  • Aging and photoaging research:

    • Examining age-related changes in Acer1 expression and activity

    • Investigating Acer1's role in photoaging processes

    • Developing ceramidase-based approaches for maintaining epidermal homeostasis during aging

These applications build upon the fundamental research showing Acer1's critical role in epidermal homeostasis and hair follicle maintenance , suggesting that modulating its activity could have therapeutic potential for various skin conditions.

What novel experimental approaches could advance understanding of Acer1 function in hair follicle stem cells?

Innovative experimental approaches to elucidate Acer1 function in hair follicle stem cells include:

  • Advanced imaging techniques:

    • Intravital imaging to track hair follicle stem cell dynamics in Acer1−/− mice in real time

    • Super-resolution microscopy to visualize ceramide distribution in stem cell niches

    • Label-retention assays combined with sphingolipid probes to correlate stem cell quiescence with ceramide profiles

  • Single-cell technologies:

    • Single-cell RNA sequencing to identify Acer1-responsive gene networks in hair follicle stem cells

    • Single-cell lipidomics to characterize cell-specific sphingolipid profiles

    • CyTOF or spectral flow cytometry for multiparametric analysis of stem cell markers and signaling states

  • Organoid and ex vivo models:

    • Hair follicle organoids from Acer1−/− and wild-type mice to study autonomous effects

    • Skin-on-chip systems to control microenvironmental factors while manipulating Acer1 activity

    • Ex vivo hair follicle cultures with ceramide modulation to assess direct effects on cycling

  • Genetic interaction screens:

    • CRISPR-based screens to identify synthetic interactions with Acer1 in hair follicle stem cells

    • Genetic modifier screens using ENU mutagenesis to identify suppressors of Acer1−/− phenotypes

    • Yeast two-hybrid or BioID approaches to map Acer1 protein interaction networks

  • In vivo lineage tracing:

    • Genetic lineage tracing to track the fate of Acer1-deficient stem cells during hair cycling

    • Dual recombinase systems to simultaneously trace multiple stem cell populations

    • Clonal analysis to determine Acer1's impact on stem cell self-renewal versus differentiation

These approaches would build upon existing evidence of Acer1's importance in hair follicle stem cell maintenance and could reveal the molecular mechanisms by which ceramide metabolism regulates stem cell function in the hair follicle niche.

How might cross-species comparisons of Acer1 function inform translational research?

Cross-species comparative studies of Acer1 can significantly enhance translational research potential:

  • Evolutionary conservation analysis:

    • Compare Acer1 gene and protein sequences across mammals to identify conserved functional domains

    • Examine species-specific variations in ceramidase activity and substrate specificity

    • Correlate natural variations in Acer1 structure with species-specific hair and skin characteristics

  • Human-mouse comparative studies:

    • Analyze human ACER1 expression patterns in comparison to mouse Acer1

    • Investigate whether human ACER1 polymorphisms correlate with hair or skin phenotypes

    • Develop humanized mouse models expressing human ACER1 variants

  • Comparative disease models:

    • Examine Acer1 expression and function in naturally occurring animal models of skin disease

    • Compare sphingolipid profiles in human skin disorders with those in Acer1-deficient mice

    • Investigate whether Acer1 deficiency mimics aspects of human hyperkeratotic or hair loss disorders

  • Translational validation approaches:

    • Test human skin explants with recombinant mouse Acer1 to assess cross-species activity

    • Compare ceramide metabolism in human and mouse skin under comparable conditions

    • Develop assays to measure ACER1 activity in human skin samples for clinical correlation

  • Comparative therapeutic response studies:

    • Evaluate whether modulating Acer1 activity produces similar effects across species

    • Determine if species differences in ceramide metabolism affect therapeutic outcomes

    • Establish predictive biomarkers for Acer1-targeted interventions that translate across species

This comparative approach would enhance the translational relevance of mouse Acer1 research findings and help identify the most promising therapeutic applications for human skin and hair disorders.

What consensus emerges from current Acer1 research?

Current research on Alkaline Ceramidase 1 (Acer1) reveals several key consensus points:

  • Acer1 plays an essential role in maintaining epidermal homeostasis through regulation of ceramide metabolism, with particularly strong activity against very-long-chain ceramides .

  • Genetic deletion of Acer1 in mice causes significant phenotypic changes including progressive hair loss, cyclical alopecia, altered hair follicle morphology and cycling, and epidermal abnormalities .

  • Acer1 deficiency leads to complex changes in the sphingolipid profile of the skin, with increased levels of various ceramide species and compensatory changes in expression of other sphingolipid metabolism enzymes .

  • The balance between different ceramide species appears critical for maintaining proper cellular functions in the epidermis, with Acer1 serving as a key regulator of this balance .

  • Hair follicle stem cell maintenance requires proper Acer1 function, suggesting that ceramide metabolism plays an important role in stem cell biology within the skin .

This consensus provides a foundation for future research into the therapeutic potential of targeting Acer1 and ceramide metabolism in skin disorders and hair loss conditions.

How might recombinant Acer1 research contribute to our understanding of ceramide biology beyond the skin?

Research on recombinant mouse Acer1 has implications that extend beyond skin biology to broader ceramide signaling across multiple physiological systems:

  • Ceramide metabolism in tissue homeostasis: Insights from Acer1 research may inform understanding of how ceramide balance maintains homeostasis in other epithelial tissues with high turnover rates.

  • Stem cell regulation: The role of Acer1 in hair follicle stem cell maintenance suggests that ceramide metabolism may be a more general regulator of adult stem cell function in various niches.

  • Cellular stress responses: Ceramides function as stress response mediators, and Acer1 research helps elucidate how cells modulate these signals through enzymatic regulation.

  • Aging biology: Age-related changes in Acer1-deficient mice may provide insights into how ceramide metabolism contributes to tissue aging across multiple systems.

  • Inflammatory regulation: The altered ceramide profiles in Acer1-deficient mice may inform understanding of how sphingolipids modulate inflammatory responses in multiple tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.