Recombinant Mouse Alkaline ceramidase 3 (Acer3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type in advance for preferential development.
Synonyms
Acer3; Aphc; Phca; Alkaline ceramidase 3; AlkCDase 3; Alkaline CDase 3; Alkaline phytoceramidase; aPHC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Acer3
Target Protein Sequence
MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLE KRYIAAYLALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYH LLFTLFLYSLTVTTIYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTWVYPWLRGLGYTSLT VFLLGFLLWNIDNIFCDSLRNFRKRVPPVLGVTTQFHAWWHILTGLGSYLHILFSLYTRT LYLRYRPKVKFLFGIWPAVMFEPQRKH
Uniprot No.

Target Background

Function
Alkaline ceramidase 3 (ACER3) is an endoplasmic reticulum and Golgi-resident ceramidase that hydrolyzes unsaturated long-chain C18:1, C20:1, and C20:4 ceramides, dihydroceramides, and phytoceramides into sphingoid bases (e.g., sphingosine) and free fatty acids at alkaline pH. Ceramides, sphingosine, and sphingosine-1-phosphate (S1P) are bioactive lipids regulating cellular signaling pathways crucial for cell proliferation, apoptosis, and differentiation. ACER3 controls sphingosine generation in erythrocytes and, consequently, plasma S1P levels. Its regulation of ceramide and S1P homeostasis in the brain may contribute to neuronal survival and function. Furthermore, by modulating pro-inflammatory ceramide levels in immune cells and tissues, ACER3 may regulate the inflammatory response.
Gene References Into Functions
  1. ACER3 expression significantly impacts the innate immune response by regulating pro-inflammatory cytokine expression in innate immune cells via C18:1-ceramide. PMID: 26938296
  2. ACER3 plays a critical protective role in maintaining sphingolipid homeostasis (ceramides, sphingosine, S1P, and complex sphingolipids) in the brain, thereby protecting Purkinje cells from premature degeneration. PMID: 26474409
Database Links
Protein Families
Alkaline ceramidase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Up-regulated with age in cerebeLlum and cerebrum.

Q&A

What is the structural architecture of mouse Acer3 and how does it compare to human ACER3?

Mouse Acer3, like its human counterpart, possesses a seven-transmembrane domain (7TM) architecture with opposite N- and C-terminus domains. The enzyme harbors a catalytic Zn²⁺ binding site in its core, structurally similar to adiponectin receptors (ADIPORs) despite low sequence identity (14% with ADIPOR1 and 10% for ADIPOR2). The transmembrane fold suggests that Acer3 has an intracellular N-terminus exposed to the cytoplasm and a C-terminus facing the lumen. This topology has been confirmed through time-resolved fluorescence resonance energy transfer (TR-FRET) experiments in living cells . The high structural conservation between mouse and human ACER3 makes mouse models particularly valuable for translational research.

What is the substrate specificity of mouse Acer3 and how does it influence experimental design?

Mouse Acer3 exhibits notable substrate specificity, preferentially catalyzing the hydrolysis of ceramides carrying unsaturated long acyl chains (C18:1 or C20:1) with significantly higher efficiency than saturated ceramides. This substrate preference must be carefully considered when designing experiments, as using inappropriate ceramide substrates may lead to false negative results regarding Acer3 activity. For optimal detection of Acer3 activity, researchers should utilize unsaturated ceramides, particularly C18:1 ceramide as substrate . Notably, Acer3 can process ceramides, dihydroceramides, and phytoceramides carrying an unsaturated long acyl chain with similar efficiency, which provides flexibility in experimental substrate selection depending on specific research questions .

How does Acer3 expression vary across different mouse tissues and developmental stages?

Acer3 is widely expressed across mouse tissues but exhibits tissue-specific expression patterns, with particularly high expression in the brain. Within the brain, Acer3 mRNA levels are significantly higher in the cerebellum compared to the cerebrum . Age-dependent regulation is a critical feature of Acer3 expression, with notable upregulation observed in the aging mouse brain. Quantitative real-time PCR analyses have demonstrated that Acer3 mRNA levels increase in both cerebrum and cerebellum of C57BL6/J mice at 8 months of age compared to 6-week-old mice . This age-dependent increase in expression corresponds with elevated enzymatic activity toward NBD-C12-PHC (a synthetic substrate specific for Acer3), suggesting that Acer3 upregulation may be an adaptive response in the aging brain to maintain ceramide homeostasis .

What are the most effective protocols for recombinant mouse Acer3 expression and purification?

For successful recombinant mouse Acer3 expression and purification, researchers should consider using a fusion protein approach to enhance stability and expression. Based on structural studies of human ACER3, a fusion construct incorporating a thermostabilized apocytochrome b562RIL (BRIL) can significantly improve protein stability and crystallization properties . Expression in mammalian systems is preferable to maintain proper post-translational modifications and folding.

Purification typically involves solubilization with the detergent L-MNG, followed by affinity chromatography utilizing poly-histidine tags. Critical buffer components should include 150 mM NaCl, 20 mM HEPES (pH 7.5), and 0.2 mM CaCl₂, as calcium ions are essential for maintaining proper structural conformation and enzymatic activity . To enhance yield and purity, consider a two-step purification process involving metal affinity chromatography followed by size exclusion chromatography. Successful purification can yield protein amenable to both functional studies and structural analyses, including crystallography trials.

What assay systems are available for measuring mouse Acer3 activity in vitro?

Several assay systems have been developed to measure Acer3 activity in vitro, with fluorescence-based approaches offering the highest sensitivity and throughput capability. A particularly effective approach involves FRET-based assays utilizing chemically engineered ceramides called FRETceramides. This method has been miniaturized and optimized for high-throughput screening applications .

When selecting an activity assay, researchers should consider the substrate preference of Acer3 for unsaturated ceramides. The synthetic substrate NBD-C12-phytoceramide (NBD-C12-PHC) has proven effective for specific detection of Acer3 activity in biochemical assays . For more detailed metabolite analysis, liquid chromatography-tandem mass spectrometry (LC-MS/MS) provides comprehensive profiling of ceramide species and their metabolites, allowing researchers to monitor changes in specific ceramide species such as C18:1-ceramide, which is a preferred substrate for Acer3 .

How can I establish an Acer3 knockout or knockdown model to study its function?

For generating Acer3 knockout mouse models, Cre-loxP technology has been successfully employed to create both global and tissue-specific knockouts. When designing conditional knockout strategies, targeting critical catalytic regions, particularly those involving the Zn²⁺ binding site, ensures complete loss of enzymatic function. For floxed mouse construction, loxP sites should be positioned to minimize disruption of neighboring genes while ensuring complete excision of critical exons .

For in vitro studies, siRNA or shRNA approaches targeting Acer3 mRNA have proven effective. When designing silencing constructs, researchers should target regions with minimal sequence similarity to other ceramidases to prevent off-target effects. Validation of knockdown efficacy should include both mRNA quantification and functional assessment of ceramidase activity, particularly using Acer3-specific substrates such as C18:1-ceramide. In HepG2 cells, successful Acer3 knockdown has been demonstrated to alter ceramide metabolism and modify cellular responses to lithocholic acid treatment, providing a useful in vitro model for studying Acer3 function in hepatic cells .

How does Acer3 deficiency affect ceramide homeostasis and what analytical methods best capture these changes?

Acer3 deficiency leads to distinctive alterations in ceramide profiles, with significant accumulation of unsaturated ceramide species, particularly C18:1-ceramide and C20:1-ceramide. These changes reflect the substrate specificity of Acer3 and provide a characteristic fingerprint of its functional loss. For comprehensive analysis of ceramide changes, lipidomic profiling using liquid chromatography-mass spectrometry (LC-MS) offers the highest sensitivity and specificity .

When analyzing ceramide species in Acer3-deficient models, researchers should employ both targeted and untargeted approaches. Targeted analysis should focus on key Acer3 substrates (C18:1 and C20:1 ceramides) while untargeted analysis may reveal unexpected alterations in other sphingolipid species. Importantly, tissue-specific differences in ceramide accumulation patterns have been observed, with particularly pronounced changes in the brain tissue of Acer3 knockout mice . Subcellular fractionation studies reveal that CER(d18:1/18:1) shows increased nuclear localization in Acer3-deficient models, suggesting compartment-specific effects of Acer3 deficiency on ceramide distribution .

What are the molecular mechanisms by which Acer3 regulates neuronal function and survival?

Acer3 plays a critical role in neuronal function and survival through multiple mechanisms. The enzyme is essential for maintaining proper ceramide homeostasis in the brain, with age-dependent upregulation suggesting an adaptive response to protect against ceramide accumulation during aging. Acer3 deficiency leads to premature degeneration of Purkinje cells and cerebellar ataxia in mice, indicating its critical role in neuronal survival .

At the molecular level, Acer3 deficiency disrupts the balance between ceramides and their metabolites, including sphingosine and sphingosine-1-phosphate (S1P). This imbalance affects numerous downstream signaling pathways involved in cell survival, differentiation, and inflammation. Research suggests that aberrant levels of ceramides in the brain, particularly unsaturated ceramide species (C18:1 and C20:1), may contribute to neurological disorders by interfering with myelination processes .

The E33G mutation in human ACER3, identified in patients with progressive leukodystrophy, impairs ceramidase activity and leads to increased levels of C18:1 and C20:1 ceramides in patient blood. This suggests that proper regulation of these specific ceramide species by ACER3 is essential for central nervous system myelination and function .

How does Acer3 interact with transcription factors and other regulatory proteins to influence gene expression?

Recent research has uncovered a fascinating interaction between Acer3 and the liver X receptor beta (LXRβ) transcriptional pathway. In hepatic models, Acer3 ablation leads to upregulation of LXRβ, influencing downstream gene expression patterns. Mechanistically, CER(d18:1/18:1), which accumulates upon Acer3 deficiency, appears to function as a ligand for LXRβ .

In silico docking analysis has demonstrated that CER(d18:1/18:1) binds to the LXRβ ligand-binding domain (LBD) primarily through hydrophobic interactions, displaying moderate predicted affinity. Upon Acer3 deficiency, increased nuclear localization of CER(d18:1/18:1) colocalizes with LXRβ, supporting a functional CER(d18:1/18:1)-LXRβ interaction . This interaction influences the expression of genes involved in bile acid metabolism, particularly sulfotransferase family 2A member 1 (SULT2A1), which catalyzes bile acid sulfation. Functional experiments have confirmed that Acer3 knockdown enhances SULT2A1 promoter activity through an LXRβ-dependent mechanism .

What disease models can benefit from studying Acer3 dysfunction?

Several disease models can benefit significantly from investigating Acer3 dysfunction. Neurological disorder models, particularly those involving progressive leukodystrophy, can provide valuable insights into how Acer3 mutations affect myelination and neuronal function. The E33G mutation in human ACER3 has been identified in patients with progressive leukodystrophy, causing impaired ACER3 ceramidase activity that leads to increased levels of C18:1 and C20:1 ceramides .

Acer3 knockout mice exhibit cerebellar ataxia due to premature degeneration of Purkinje cells, making them valuable models for studying cerebellar disorders . Additionally, models of colon inflammation and cancer can benefit from Acer3 research, as modulation of C18:1 ceramide levels by Acer3 regulates immune responses, while deficiency increases colon inflammation and associated tumorigenesis .

Hepatic models of cholestasis have revealed that Acer3 deficiency can attenuate bile acid-induced liver injury through activation of the LXRβ-SULT2A1 pathway, suggesting therapeutic potential in cholestatic liver diseases . Furthermore, Acer3's role in acute myeloid leukemia (AML) pathogenesis makes it relevant for hematological cancer models, as ACER3 expression negatively correlates with AML patient survival, and ACER3 is essential for the growth of AML cells .

How does mouse Acer3 function differ from human ACER3, and what are the implications for translational research?

While the E33G mutation in human ACER3 causes progressive leukodystrophy characterized by neurological regression, truncal hypotonia, appendicular spasticity, and neurogenic bladder, Acer3 knockout in mice does not affect myelination but instead leads to premature degeneration of Purkinje cells and cerebellar ataxia . This disparity suggests species-specific roles in neurological function and development.

Tissue distribution patterns show subtle differences, with relatively higher expression of Acer3 in mouse cerebellum compared to cerebrum , which should be considered when designing tissue-specific studies. Despite these differences, the core enzymatic function and substrate specificity appear highly conserved, supporting the translational value of mouse models for studying basic mechanisms of ACER3 function and for drug development targeting this enzyme .

What are the characteristics of effective Acer3 inhibitors and how can they be screened?

Effective Acer3 inhibitors exhibit several key characteristics: they typically interact with the enzyme inside its transmembrane region, possess suitable physicochemical properties for membrane penetration, demonstrate selectivity for Acer3 over other ceramidases, and exhibit potency in the submicromolar range. Compound 03 (ES_ACR15) has been identified as a potent inhibitor with an IC₅₀ of 0.71 μM .

For screening potential inhibitors, FRET-based assays utilizing FRETceramides have proven particularly effective and amenable to high-throughput screening. This approach has been successfully miniaturized and used to screen libraries containing thousands of compounds . When evaluating hits, researchers should assess not only inhibitory potency but also selectivity against other ceramidases (particularly neutral ceramidase and acid ceramidase) and cell permeability.

Structure-activity relationship studies guided by computational approaches, including docking and replica-exchange molecular dynamics simulations, have revealed that the most effective inhibitors interact with specific residues in the transmembrane region of ACER3, particularly forming interactions with Tyr149 on transmembrane helix 5 (TM5) . This structural knowledge can guide further optimization of lead compounds.

What experimental approaches are most effective for validating Acer3 inhibitors in cellular and animal models?

Validation of Acer3 inhibitors requires a multi-tiered experimental approach. In cellular models, researchers should first confirm target engagement and enzyme inhibition by measuring ceramidase activity using specific substrates such as NBD-C12-PHC. Lipidomic analysis should demonstrate accumulation of Acer3-specific substrates (particularly C18:1 and C20:1 ceramides) upon inhibitor treatment, creating a profile similar to genetic Acer3 knockdown .

Functional cellular assays should evaluate phenotypic changes consistent with Acer3 inhibition. In hepatic cells, for instance, effective inhibitors should mimic the effects of genetic Acer3 knockdown on LXRβ-SULT2A1 pathway activation and protection against bile acid toxicity . Assessment of inhibitor selectivity is crucial, requiring parallel evaluation against multiple ceramidases using specific substrates for each enzyme.

For in vivo validation, pharmacokinetic studies should confirm adequate bioavailability and tissue distribution, particularly to target tissues such as brain for neurological applications. Efficacy studies should demonstrate target engagement through changes in tissue ceramide profiles, focusing on Acer3-specific substrates. Phenotypic outcomes should be consistent with the known biology of Acer3, such as altering bile acid metabolism in liver models or affecting neurological function in CNS-targeted applications .

How can researchers distinguish between direct and indirect effects of Acer3 modulation in complex biological systems?

Distinguishing between direct and indirect effects of Acer3 modulation requires careful experimental design and multiple complementary approaches. Acute inhibition or activation models (using selective inhibitors or recombinant enzyme) help identify immediate consequences of Acer3 modulation, likely representing direct effects. Conversely, chronic models (genetic knockouts or stable knockdowns) may reveal both direct and compensatory indirect effects.

Rescue experiments provide powerful evidence for direct effects - if reconstituting wild-type Acer3 expression in knockout models reverses a phenotype, this strongly supports a direct relationship. Conversely, if phenotypes persist despite enzyme reconstitution, indirect or developmental effects are likely involved. Researchers should also consider temporal dynamics, as immediate biochemical changes (ceramide accumulation) are likely direct consequences, while downstream transcriptional responses may represent secondary adaptations .

Mechanistic studies incorporating intermediates in putative pathways can clarify causality. For example, in hepatic models, the observation that silencing LXRβ abolishes the protective effects of Acer3 knockdown supports a mechanistic pathway where Acer3 affects cell survival through LXRβ-dependent mechanisms . Multi-omics approaches combining lipidomics, transcriptomics, and proteomics can help construct causal networks to distinguish primary from secondary effects of Acer3 modulation.

What are the most common technical challenges in recombinant Acer3 research and how can they be addressed?

Recombinant Acer3 research faces several technical challenges, primarily related to the membrane-integrated nature of this enzyme. Protein expression and purification difficulties arise due to Acer3's multiple transmembrane domains, which often lead to poor yield and stability. Researchers can address this by using fusion constructs like BRIL-ACER3 that enhance stability, optimizing detergent selection (L-MNG has proven effective), and including stabilizing agents such as calcium in purification buffers .

Activity assay sensitivity can be problematic, particularly when using suboptimal substrates. Researchers should select assay systems utilizing Acer3's preferred substrates (unsaturated ceramides like C18:1-ceramide) and consider FRET-based approaches that offer enhanced sensitivity . For challenging samples with low expression, enzymatic amplification strategies or extended incubation periods may improve detection limits.

In cellular and animal models, compensatory upregulation of other ceramidases can complicate data interpretation. Comprehensive profiling of all ceramidase family members and targeted evaluation of their respective substrates helps identify such compensatory mechanisms. Time-course studies are valuable for distinguishing between acute responses to Acer3 modulation and longer-term compensatory adaptations that may mask or modify the primary effects .

How should inconsistent results between in vitro and in vivo Acer3 studies be reconciled?

Inconsistencies between in vitro and in vivo Acer3 studies are not uncommon and can stem from multiple factors. Different microenvironmental conditions significantly impact Acer3 function - the enzyme's activity depends on proper membrane composition, pH, and calcium availability, which vary considerably between simplified in vitro systems and complex in vivo environments. Researchers should attempt to replicate physiological conditions in vitro by incorporating appropriate lipid compositions and maintaining optimal calcium concentrations .

Complex regulatory networks present in vivo but absent in vitro can modify Acer3 function and consequences of its modulation. For example, the influence of Acer3 on LXRβ-dependent transcriptional regulation involves multiple cellular components and feedback mechanisms that may be incomplete in simplified cell models . Researchers should consider using more complex in vitro systems (e.g., organoids, co-cultures) that better capture regulatory networks.

Pharmacokinetic factors affecting inhibitor distribution and metabolism in vivo may explain efficacy differences compared to in vitro studies. For instance, compounds showing potent Acer3 inhibition in cell-free assays may have limited tissue penetration or rapid metabolism in vivo. Thorough pharmacokinetic characterization of compounds, including tissue distribution studies focusing on target organs such as brain or liver, helps reconcile such discrepancies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.