Recombinant Mouse Alpha-1D adrenergic receptor (Adra1d)

Shipped with Ice Packs
In Stock

Description

Introduction to Alpha-1D Adrenergic Receptor

The Alpha-1D adrenergic receptor (Adra1d) belongs to the family of G protein-coupled receptors (GPCRs) that respond to catecholamines such as norepinephrine and epinephrine. It represents one of the three alpha-1 adrenergic receptor subtypes: alpha-1A, alpha-1B, and alpha-1D . These receptors signal primarily through the Gq/11 family of G-proteins and demonstrate different patterns of activation and tissue distribution . The alpha-1 adrenergic receptors constitute a fundamental component of the sympathetic nervous system, mediating various physiological responses including vasoconstriction, myocardial contraction, and cellular growth regulation.

Alpha-1D adrenergic receptors activate mitogenic responses and regulate the growth and proliferation of numerous cell types . Notably, the receptor plays a crucial role in the regulation of vascular tone and blood pressure maintenance, as evidenced by studies utilizing gene targeting to create knockout mice lacking this receptor subtype .

Gene Structure

The gene encoding the Alpha-1D adrenergic receptor in mice, similar to the alpha-1B-adrenergic receptor gene, comprises two exons and a single intron that interrupts the coding region . This genomic organization allows for potential alternative splicing, although the functional significance of splice variants remains under investigation.

Tissue Distribution

The Alpha-1D adrenergic receptor demonstrates a distinctive tissue distribution pattern that differs somewhat from other alpha-1 receptor subtypes. It is prominently expressed in the cardiovascular system, particularly in blood vessels such as the aorta and other resistance arteries . Radioligand binding studies have shown that alpha-1D receptor binding capacity is significant in the aorta but minimal in cardiac tissue .

In the central nervous system, Alpha-1D adrenergic receptors are expressed in the cerebellum, where they play roles in motor function regulation. Quantitative PCR analyses have revealed that under certain pathological conditions, such as in tottering mice (a model for episodic ataxia type 2), cerebellar Alpha-1D adrenergic receptor mRNA expression can be significantly upregulated .

Altered Expression in Disease States

Research indicates that Alpha-1D adrenergic receptor expression can be significantly altered in various disease states. For instance, in tottering mice, which serve as a model for cerebellar dysfunction, Alpha-1D adrenergic receptor mRNA is significantly upregulated compared to control mice . This altered expression pattern may contribute to the pathophysiological mechanisms underlying neurological disorders characterized by motor coordination deficits.

Signaling Pathway

The Alpha-1D adrenergic receptor predominantly signals through the Gq/11 family of G-proteins, activating phospholipase C, which leads to the generation of second messengers including inositol trisphosphate (IP3) and diacylglycerol (DAG) . These second messengers trigger calcium release from intracellular stores and activate protein kinase C, respectively, initiating various downstream cellular responses.

Cardiovascular Function

One of the most well-established roles of the Alpha-1D adrenergic receptor is in cardiovascular regulation. Studies using knockout mice lacking the Alpha-1D receptor (α1D-/-) have demonstrated that this receptor subtype directly participates in sympathetic regulation of systemic blood pressure through vasoconstriction . Alpha-1D receptor knockout mice maintain significantly lower basal systolic and mean arterial blood pressure compared to wild-type mice, without significant changes in heart rate or cardiac function .

Furthermore, the contractile response of the aorta and the pressor response of isolated perfused mesenteric arterial beds to alpha-1 adrenergic stimulation are markedly reduced in Alpha-1D receptor knockout mice . These findings indicate that the Alpha-1D adrenergic receptor plays a predominant role in vascular contractions induced by alpha-1 adrenergic agonists.

Neurological Function

In the central nervous system, particularly in the cerebellum, Alpha-1D adrenergic receptors appear to play roles in motor function and may be involved in stress-induced responses. Research suggests that these receptors may primarily be located at the Purkinje cell dendritic tree and may participate in mediating stress-induced dystonia in certain mouse models .

Electrophysiological in vivo recordings have shown that inhibition of Alpha-1D adrenergic receptors can affect Purkinje cell activity, suggesting a role in cerebellar circuit function . Moreover, conditional knockdown of these receptors in the cerebellum using small hairpin RNAs has been shown to reduce stress-induced dystonia in susceptible mouse models .

Applications in Binding Studies

Recombinant mouse Alpha-1D adrenergic receptor proteins serve as valuable tools for ligand binding studies, enabling characterization of receptor-ligand interactions and screening of potential therapeutic compounds. The availability of purified recombinant receptor facilitates the development of high-throughput screening assays for identifying selective agonists and antagonists.

Gene Targeting Approaches

To delineate the specific roles of Alpha-1D adrenergic receptors in physiological processes, researchers have developed various genetic tools, including knockout mice lacking this receptor subtype . These models have been instrumental in elucidating the role of Alpha-1D receptors in cardiovascular regulation and other physiological functions.

Conditional Genetic Manipulation

More sophisticated genetic approaches using the Cre-loxP system have been developed to target the Alpha-1D adrenergic receptor in a tissue-specific manner . These tools include:

  1. Alpha-1D adrenergic receptor floxed mice, with loxP sites flanking at least one exon near the 5' end of the gene

  2. Alpha-1D adrenergic receptor reactivation (transcriptional blocking) mice

  3. Alpha-1D adrenergic receptor Cre mice

These genetic tools allow for conditional deletion or reactivation of the receptor in specific tissues, enabling precise dissection of its roles in different physiological contexts .

RNA Interference Approaches

RNA interference techniques using small hairpin RNAs (shRNAs) targeting Alpha-1D adrenergic receptor mRNA have been employed to conditionally knockdown these receptors in specific tissues, such as the cerebellum . This approach has proven effective in reducing receptor expression and altering physiological responses, such as stress-induced dystonia in susceptible mouse models .

Selective Ligands

Several compounds have been identified as selective antagonists for the Alpha-1D adrenergic receptor, including:

  • BMY 7378 (also an alpha-2C antagonist)

  • A-315456

  • Domesticine

  • Cyclazosin (with slight alpha-1C selectivity)

  • Tamsulosin (with roughly equal affinity for alpha-1A)

These selective ligands serve as valuable tools for investigating the specific roles of Alpha-1D adrenergic receptors in various physiological and pathological processes.

Therapeutic Implications

The understanding of Alpha-1D adrenergic receptor function has important implications for therapeutic strategies. Given its significant role in vascular tone regulation, antagonists targeting this receptor subtype may have potential applications in the treatment of hypertension and other cardiovascular disorders .

Furthermore, the involvement of Alpha-1D adrenergic receptors in cerebellar function suggests potential therapeutic applications in neurological disorders characterized by motor dysfunction. For instance, antagonizing Alpha-1D adrenergic receptors has been shown to decrease the frequency and severity of dystonic episodes in certain mouse models .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may arise. If you have a particular format preference, please indicate it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, we recommend contacting your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
In general, the shelf life of liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will strive to incorporate the specified tag type if you have a particular preference. Please inform us of any tag type requirements, and we will prioritize their implementation.
Synonyms
Adra1d; Adra1a; Gpcr8; Alpha-1D adrenergic receptor; Alpha-1A adrenergic receptor; Alpha-1D adrenoreceptor; Alpha-1D adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-562
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTFRDILSVTFEGPRASSSTGGSGAGGGAGTVGPEGPAVGGVPGATGGSAVVGTGSGEDN QSSTAEAGAAASGEVNGSAAVGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRH LQTVTNYFIVNLAVADLLLSAAVLPFSATMEVLGFWPFGRTFCDVWAAVDVLCCTASILS LCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVPPDERFC GITEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRI HCRGAATSAKGNPGTQSSKGHTLRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFF VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRR RLWPSLRPPLASLDRRPALRLCPQPAHRTPRGSPSPHCTPRPGLRRHAGGAGFGLRPSKA SLRLREWRLLGPLQRPTTQLRAKVSSLSHKFRSGGARRAETACALRSEVEAVSLNVPQDG AEAVICQAYEPGDLSNLRETDI
Uniprot No.

Target Background

Function
This alpha-adrenergic receptor exerts its effect through the influx of extracellular calcium.
Database Links

UniGene: Mm.389380

Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1D sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse Adra1d and how does it compare to other adrenergic receptor subtypes?

Mouse Adra1d belongs to the G protein-coupled receptor superfamily and signals through the Gq/11 family of G-proteins. The gene comprises 2 exons and a single intron that interrupts the coding region, similar to the alpha-1B-adrenergic receptor gene . The receptor contains seven transmembrane domains characteristic of GPCRs and shares significant homology with other alpha-1 receptor subtypes (alpha-1A and alpha-1B) .

Unlike the previously misidentified alpha-1C subtype (which was later found to be identical to alpha-1A), alpha-1D represents a distinct receptor subtype with unique pharmacological properties and tissue distribution patterns . When comparing binding pockets across adrenergic receptor subtypes, alpha-1D shows specific interaction patterns that can be exploited for selective ligand development .

What are the primary signaling pathways activated by mouse Adra1d?

Mouse Adra1d primarily signals through the Gq/11 pathway, leading to the activation of phospholipase C, generation of inositol trisphosphate (IP3) and diacylglycerol (DAG), and subsequent calcium mobilization and protein kinase C (PKC) activation . This signaling cascade ultimately leads to:

  • Activation of mitogenic responses

  • Regulation of cell growth and proliferation

  • Modulation of gene expression

  • Smooth muscle contraction in various tissues

Adra1d shows distinct patterns of activation compared to other alpha-1 subtypes, with different sensitivities to agonists and antagonists despite signaling through the same G-protein family .

What tissue distribution pattern does mouse Adra1d exhibit?

Mouse Adra1d expression can be detected in multiple tissues, with variation in expression levels. Based on available antibody reactivity data and RNA expression profiles, Adra1d is found in:

  • Vascular smooth muscle cells

  • Central nervous system tissues

  • Cardiac tissues

  • Urogenital system components

  • Various other peripheral tissues

Unlike human ADRA1D, which has been associated with vascular conditions and potentially pre-eclampsia, mouse Adra1d tissue-specific functions remain an active area of investigation . When designing expression studies, it's important to select appropriate positive control tissues where Adra1d is known to be highly expressed.

What expression systems are optimal for producing recombinant mouse Adra1d protein?

For functional studies of recombinant mouse Adra1d, mammalian expression systems are strongly preferred over bacterial or insect cell systems due to the need for proper post-translational modifications and membrane insertion. Recommended approaches include:

  • HEK293 cells: Provide high transfection efficiency and proper receptor processing

  • CHO cells: Offer stable expression and minimal endogenous adrenergic receptor background

  • Neuro2A cells: Useful for neuronal context studies of Adra1d function

Expression vectors should contain strong promoters (CMV or EF1α) and appropriate targeting sequences. For structural studies, addition of thermostabilizing mutations and fusion partners (such as T4 lysozyme) may be necessary to improve protein stability and crystallization properties .

When expressing the receptor, consider using codon-optimized sequences for mouse Adra1d and inducible expression systems to control expression levels, as overexpression can lead to aggregation and misfolding.

What are the recommended methods for detecting and quantifying mouse Adra1d expression?

Multiple validated methods are available for detecting mouse Adra1d expression:

  • Western Blot (WB): Several antibodies show cross-reactivity with mouse Adra1d and can be used for protein quantification

  • Immunohistochemistry (IHC): For tissue localization studies, both paraffin-embedded and frozen sections can be analyzed

  • Immunofluorescence (IF): Allows subcellular localization studies and co-localization with signaling partners

  • Flow Cytometry (FACS): Useful for quantifying surface expression levels in cell populations

  • RT-qPCR: For mRNA expression analysis, though correlation with protein levels should be validated

When selecting antibodies, consider those validated specifically for mouse reactivity. Several commercial antibodies have been confirmed to detect mouse Adra1d in multiple applications, including polyclonal antibodies with epitopes targeting various regions of the receptor .

What functional assays are recommended for characterizing recombinant mouse Adra1d activity?

To assess the functionality of recombinantly expressed mouse Adra1d, consider these validated assays:

  • Calcium mobilization assays: Using fluorescent calcium indicators (Fluo-4, Fura-2) to measure Gq-mediated calcium release

  • Inositol phosphate accumulation: Measuring IP3 generation following receptor activation

  • ERK1/2 phosphorylation: Assessing downstream MAPK pathway activation

  • Receptor binding assays: Using radiolabeled or fluorescent ligands to determine binding affinities

  • Receptor internalization studies: Tracking receptor trafficking following agonist stimulation

The calcium flux assay is particularly well-established for testing compounds targeting alpha adrenergic receptors, as demonstrated in structure-activity relationship studies of novel antagonists . When designing these assays, include appropriate positive controls (known Adra1d agonists like phenylephrine) and negative controls (vehicle and cells not expressing the receptor).

How can I develop selective ligands for mouse Adra1d versus other adrenergic receptor subtypes?

Developing selective ligands for mouse Adra1d requires understanding the structural determinants of selectivity. Based on molecular docking studies of adrenergic receptors:

  • Focus on exploiting unique interactions in the Adra1d binding pocket, particularly residues that differ from Adra1a and Adra1b

  • Consider structure-based drug design approaches using available crystal structures or homology models

  • Utilize molecular docking to predict key interactions, such as:

    • Salt bridge formation with conserved aspartate residues

    • Hydrogen bonding networks with specific residues in transmembrane domains

    • Aromatic interactions with hydrophobic pocket residues

For experimental validation of selectivity, test candidate compounds against all three alpha-1 subtypes (Adra1a, Adra1b, Adra1d) in parallel assays. Calcium flux assays in cells expressing individual subtypes have proven effective for determining subtype selectivity . Consider radioligand displacement assays as complementary approaches to functional studies.

What are the considerations for creating Adra1d knockout or transgenic mouse models?

When designing genetic mouse models for Adra1d research:

  • Knockout strategies:

    • Consider conventional vs. conditional approaches (tissue-specific or inducible)

    • Target exons encoding critical receptor domains for complete functional disruption

    • Remember that compensatory upregulation of other alpha-1 subtypes may occur

  • Knock-in approaches:

    • For reporter models, ensure tag insertion doesn't disrupt receptor trafficking or function

    • For humanized models, consider species differences in pharmacology and signaling

  • Validation requirements:

    • Confirm gene modification by genotyping and sequencing

    • Verify protein absence/modification by Western blot and IHC

    • Assess functional consequences with in vivo and ex vivo assays

    • Evaluate compensatory changes in other adrenergic receptor subtypes

Given Adra1d's role in vascular function and potential involvement in conditions like pre-eclampsia, careful phenotyping of cardiovascular parameters is essential in any genetic model .

How can I distinguish Adra1d-specific effects from those mediated by other alpha-1 receptor subtypes in mouse tissues?

Distinguishing subtype-specific effects in native tissues can be challenging due to co-expression. Recommended approaches include:

  • Pharmacological dissection:

    • Use subtype-selective antagonists (e.g., BMY 7378 for Adra1d)

    • Apply selective irreversible antagonists to occlude specific receptor populations

    • Employ combination approaches with selective ligands at varying concentrations

  • Genetic approaches:

    • Compare responses in wild-type versus Adra1d knockout tissues

    • Use siRNA/shRNA knockdown in isolated primary cells

    • Implement CRISPR-based targeting in relevant cell types

  • Analytical considerations:

    • Perform careful concentration-response analyses to identify potential multi-receptor components

    • Apply mathematical modeling to dissect contributions of different receptor subtypes

    • Include appropriate controls with selective tools for Adra1a and Adra1b

How do I address common challenges in recombinant mouse Adra1d expression systems?

When working with recombinant mouse Adra1d, researchers frequently encounter these challenges:

  • Low expression levels:

    • Optimize codon usage for mammalian expression

    • Include signal sequences to enhance membrane trafficking

    • Test different cell lines (HEK293, CHO-K1, COS-7)

    • Consider stable cell line generation rather than transient transfection

  • Non-functional receptor:

    • Verify protein expression via Western blot or flow cytometry

    • Assess membrane localization via immunofluorescence

    • Test multiple agonists at varying concentrations

    • Ensure coupling to downstream signaling components

  • Receptor aggregation:

    • Include chemical chaperones in culture media

    • Lower expression temperature (30-32°C)

    • Use inducible expression systems to control expression levels

    • Add stabilizing mutations for structural studies

For optimal detection, select antibodies validated specifically for mouse Adra1d, as antibody performance can vary significantly between applications like Western blot, immunohistochemistry, and flow cytometry .

What controls should be included in pharmacological studies with recombinant mouse Adra1d?

Robust experimental design for Adra1d pharmacology studies should include:

  • Positive controls:

    • Known Adra1d agonists (phenylephrine, norepinephrine)

    • Established antagonists with known potency values

    • Positive control tissues/cell lines with verified Adra1d expression

  • Negative controls:

    • Untransfected/mock-transfected cells

    • Cells expressing related receptors (Adra1a, Adra1b) for selectivity assessment

    • Vehicle controls for all treatments

  • Validation controls:

    • Dose-response relationships to confirm specific binding

    • Competitive binding with known ligands

    • Blockade of responses with selective antagonists

For functional assays measuring calcium flux or other signaling events, include controls that directly activate downstream pathways (e.g., ionomycin for calcium studies) to verify assay performance independent of receptor function .

How can I analyze complex pharmacological data from mouse Adra1d studies?

For rigorous analysis of Adra1d pharmacological data:

  • Concentration-response analysis:

    • Fit data to appropriate models (Hill equation, operational model)

    • Compare EC50/IC50 values with statistical tests

    • Consider biphasic responses that may indicate multiple binding sites or receptor populations

  • Binding studies:

    • Use Scatchard analysis or nonlinear regression to determine Kd and Bmax

    • Apply competitive binding equations for antagonist studies

    • Consider allosteric interactions in complex ligand studies

  • Signaling response quantification:

    • Normalize data appropriately to account for expression level differences

    • Calculate signaling efficacy parameters (Emax, τ values)

    • Compare kinetic parameters of response onset and decay

  • Statistical approaches:

    • Use appropriate tests based on data distribution (parametric vs. non-parametric)

    • Account for repeated measures when appropriate

    • Apply multiple comparison corrections for extensive compound screening

When comparing mouse Adra1d to other species or subtypes, ensure that experimental conditions are matched to allow valid comparisons of pharmacological parameters .

What are emerging technologies for studying mouse Adra1d structure and function?

Several cutting-edge approaches are advancing our understanding of Adra1d:

  • Structural biology techniques:

    • Cryo-electron microscopy for receptor structure determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Molecular dynamics simulations based on receptor structures

    • Structure-based drug design for selective ligands

  • Advanced imaging approaches:

    • Single-molecule microscopy to track receptor behavior in real-time

    • FRET/BRET biosensors to monitor receptor activation and protein interactions

    • Super-resolution microscopy for nanoscale localization studies

  • Genetic engineering tools:

    • CRISPR-Cas9 for precise receptor modification in cells and animals

    • Optogenetic and chemogenetic approaches for controlled receptor activation

    • Targeted protein degradation technologies for temporal control of receptor expression

These emerging technologies complement traditional approaches and provide new insights into the structural basis of ligand selectivity across adrenergic receptor subtypes .

How can mouse Adra1d studies contribute to understanding human disease?

Research on mouse Adra1d has important translational implications:

  • Cardiovascular disorders:

    • Hypertension mechanisms and treatment

    • Vascular reactivity in disease models

    • Potential role in pre-eclampsia, as suggested by human genetic studies

  • Urological applications:

    • Benign prostatic hyperplasia mechanisms

    • Bladder function regulation

    • Development of targeted therapeutics

  • Neurological conditions:

    • Contribution to pain pathways

    • Involvement in autonomic regulation

    • Potential roles in neurovascular coupling

  • Drug development applications:

    • Creation of more selective alpha-1D antagonists

    • Development of novel structure-activity relationships

    • Prediction of drug effects using mouse models

While mouse models provide valuable insights, researchers should be aware of species differences in receptor pharmacology and expression patterns when translating findings to human applications .

What antibodies and detection tools are validated for mouse Adra1d research?

Several validated antibodies are available for mouse Adra1d research across multiple applications:

Antibody TypeHostApplicationsSpecies ReactivityValidationReference
PolyclonalRabbitWB, IHC(p), FACSHuman, Rat, Mouse★★★★★
PolyclonalRabbitIHC, WB, IF, FACS, ICC, LCIHuman, Rat, Mouse★★★★★
PolyclonalRabbitWBMultiple species including Mouse★★★★

When selecting detection reagents, consider:

  • Validation status for specific applications

  • Cross-reactivity with other adrenergic receptor subtypes

  • Specific epitope recognition regions

  • Compatibility with chosen experimental systems

For genetic detection, validated PCR primers targeting mouse Adra1d exons are available, with careful design needed to distinguish from other adrenergic receptor subtypes due to sequence homology .

What are the key pharmacological tools for studying mouse Adra1d?

Researchers investigating mouse Adra1d can utilize these pharmacological agents:

Agonists:

  • Phenylephrine (partial selectivity)

  • Norepinephrine (endogenous, non-selective)

  • A-61603 (shows some selectivity in comparative studies)

Antagonists:

  • BMY 7378 (Adra1d-selective)

  • Prazosin (non-selective alpha-1 antagonist)

  • Novel yohimbine derivatives with improved selectivity profiles

Experimental considerations:

  • Verify potency values specifically in mouse systems

  • Use multiple compounds to confirm findings

  • Include appropriate controls for vehicle effects

  • Test concentration ranges spanning at least 3 log units for complete characterization

Recent structure-activity relationship studies have identified novel compounds with improved selectivity profiles that may serve as valuable tools for distinguishing Adra1d-mediated effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.