Recombinant Mouse Alpha-2A adrenergic receptor (Adra2a)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Adra2a regulates physiological processes via inhibition of adenylate cyclase, reducing cAMP levels upon activation by norepinephrine or epinephrine . Key roles include:

  • Neurotransmitter Regulation: Modulates noradrenaline and dopamine release in the prefrontal cortex, impacting cognitive function .

  • Sympathetic Nervous Control: Inhibits neurotransmitter release at high neuronal stimulation frequencies .

  • Metabolic Influence: Attenuates insulin secretion via TRPM2 channel inhibition in pancreatic β-cells .

Experimental Tools

  • ELISA Kits: Detect Adra2a in serum, plasma, and tissue homogenates with a sensitivity of 0.078 ng/mL and intra/inter-assay CVs of 5.3% and 7.5%, respectively .

  • Antibodies: Recombinant monoclonal antibodies (e.g., clone 3H29L10) enable precise localization studies in mouse, monkey, and pig tissues .

  • Gene-Targeted Models: Mice lacking functional Adra2a receptors exhibit hypertension, disrupted stress responses, and altered pain perception .

Key Findings from Studies

Study FocusOutcomeCitation
Stress ResponseDorsal BNST α2A-adrenergic receptors enhance neuronal activity via HCN channels, influencing anxiety-like behaviors .
Cardiovascular Regulationα2A receptor activation lowers blood pressure, while its deletion causes hypertension .
Cognitive FunctionPrefrontal cortical α2A receptors regulate working memory and attention .

Pathological Associations

Dysregulation of Adra2a is linked to multiple diseases:

  • Neuropsychiatric Disorders: Altered receptor activity correlates with anxiety, depression, and schizophrenia .

  • Type 2 Diabetes: The rs553668 variant impairs insulin secretion, contributing to hyperglycemia .

  • Osteoarthritis: α2A signaling in chondrocytes promotes degenerative joint remodeling .

Agonist/Antagonist Specificity

AgonistsRank OrderAntagonistsRank Order
Oxymetazoline > ClonidineEpinephrine > NorepinephrineYohimbine > PhentolamineMianserine > Chlorpromazine

Source: Functional assays using recombinant Adra2a .

Technical Considerations

  • Storage: Lyophilized protein retains stability for >6 months at -80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Optimize solubility using glycerol (5–50%) and sterile water .

  • Assay Compatibility: Compatible with SDS-PAGE, ligand-binding assays, and in vitro signaling studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Adra2a; Alpha-2A adrenergic receptor; Alpha-2A adrenoreceptor; Alpha-2A adrenoceptor; Alpha-2AAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSS IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGG QQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACS APPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSE HAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKAS RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPSQLFNFFFWFGYCNSS LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase via G protein signaling.
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2A sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Alpha-2A adrenergic receptor and what are its primary functions?

Alpha-2A adrenergic receptor (Adra2a) is a member of the G protein-coupled receptor superfamily. It is one of three highly homologous subtypes (alpha2A, alpha2B, and alpha2C) of alpha-2 adrenergic receptors. These receptors play critical roles in regulating neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system .

Studies in mouse models have revealed that both ADRA2A and ADRA2C subtypes are required for normal presynaptic control of transmitter release from sympathetic nerves in the heart and from central noradrenergic neurons. Specifically, the ADRA2A subtype inhibits transmitter release at high stimulation frequencies, whereas the ADRA2C subtype modulates neurotransmission at lower levels of nerve activity .

How does Alpha-2A adrenergic receptor signaling differ from other adrenergic receptor subtypes?

Alpha-2A adrenergic receptors mediate catecholamine-induced inhibition of adenylate cyclase through G proteins. The receptor exhibits a specific pharmacological profile with a rank order of potency for agonists: oxymetazoline > clonidine > epinephrine > norepinephrine > phenylephrine > dopamine > p-synephrine > p-tyramine > serotonin = p-octopamine .

For antagonists, the rank order is: yohimbine > phentolamine = mianserine > chlorpromazine = spiperone = prazosin > propanolol > alprenolol = pindolol . This unique pharmacological profile distinguishes it from other adrenergic receptor subtypes and enables specific targeting in experimental contexts.

What physiological systems are primarily regulated by Alpha-2A adrenergic receptors?

Alpha-2A adrenergic receptors are involved in regulating multiple physiological systems, including:

  • Cardiovascular system: Regulation of blood pressure and regional blood flow

  • Metabolic pathways: Regulation of carbohydrate and fat metabolism

  • Fluid homeostasis: Regulation of fluid and electrolyte balance

  • Hematological system: Activation of platelet aggregation

  • Nervous system: Involvement in anesthesia and analgesia mechanisms

Research using recombinant mouse Alpha-2A adrenergic receptors has been instrumental in elucidating these roles, with particular significance in the central nervous system and cardiovascular regulation .

What are the optimal expression systems for producing functional recombinant mouse Adra2a protein?

When producing recombinant mouse Adra2a protein, researchers have several expression system options, each with distinct advantages:

Expression SystemAdvantagesChallengesYield
E. coliCost-effective, rapid growth, scalableLimited post-translational modifications, potential inclusion bodies0.05-1 mg range
YeastBetter protein folding, some post-translational modificationsMore complex than bacterial systems0.05-0.5 mg range
Baculovirus/Insect cellsMammalian-like post-translational modificationsHigher cost, longer production time0.05-0.1 mg range

The selection of an appropriate expression system depends on the specific research requirements. For structural studies requiring large quantities with less emphasis on post-translational modifications, E. coli may be suitable. For functional studies requiring proper receptor folding and signal transduction capabilities, insect or mammalian cell systems are often preferred .

How can researchers effectively design gene disruption studies for Alpha-2A adrenergic receptors in mouse models?

Designing effective gene disruption studies for Alpha-2A adrenergic receptors involves several methodological considerations:

  • Gene targeting strategy: The Alpha-2A Adrenergic Receptor Gene Disruption Mouse (A2aARGDM) model has been developed by targeting the coding region of the Adra2a gene. This approach ensures complete elimination of the receptor protein .

  • Phenotypic analysis protocol: Comprehensive phenotypic analysis should include:

    • Cardiovascular parameters (blood pressure, heart rate, vascular resistance)

    • Metabolic parameters (glucose tolerance, insulin sensitivity)

    • Neurological assessment (behavior, pain sensitivity, response to anesthetics)

    • Drug response studies (selective agonists and antagonists)

  • Control selection: Both wild-type littermates and other adrenergic receptor knockout models (e.g., A2bARGDM, A2cARGDM) should be included as controls to distinguish subtype-specific effects .

  • Complementary approaches: Combine gene disruption with pharmacological studies using selective ligands such as BRL 44408 maleate (selective α2A antagonist) or dexmedetomidine hydrochloride (selective α2 agonist) to validate findings .

What advanced imaging techniques are most effective for studying Adra2a localization and trafficking?

Advanced imaging techniques for studying Adra2a localization and trafficking include:

  • Confocal microscopy with fluorescently-tagged receptors: Utilizing recombinant Adra2a with fluorescent protein tags (GFP, mCherry) allows real-time visualization of receptor localization and trafficking.

  • Super-resolution microscopy: Techniques such as STORM (Stochastic Optical Reconstruction Microscopy) or PALM (Photoactivated Localization Microscopy) provide nanoscale resolution of receptor clustering and membrane dynamics.

  • FRET/BRET assays: Fluorescence or Bioluminescence Resonance Energy Transfer techniques enable detection of protein-protein interactions involving Adra2a and potential binding partners.

  • Fluorescent ligand binding: Using fluorescently labeled α2A-selective ligands such as fluorescent derivatives of BRL 44408 can reveal binding site accessibility and receptor conformational states.

  • Antibody-based detection: Highly specific antibodies such as Human alpha-2A Adrenergic R/ADRA2A Alexa Fluor® 405-conjugated Antibody can be used for immunofluorescence studies .

Combining these techniques with pharmacological manipulations using selective agonists (guanfacine, UK 14,304) or antagonists provides comprehensive insights into receptor dynamics under different signaling conditions.

How should researchers design experiments to differentiate between Alpha-2A, 2B, and 2C adrenergic receptor functions?

Designing experiments to differentiate between adrenergic receptor subtypes requires a multi-faceted approach:

  • Pharmacological approach:

    • Use subtype-selective compounds: BRL 44408 maleate (selective α2A antagonist), dexmedetomidine (α2 agonist with preference for α2A), guanfacine (α2A agonist)

    • Establish dose-response relationships with multiple ligands

    • Perform competitive binding studies with labeled and unlabeled ligands

  • Genetic approach:

    • Utilize targeted gene disruption models: A2aARGDM, A2bARGDM, A2cARGDM

    • Create tissue-specific conditional knockout models to avoid developmental compensation

    • Compare phenotypes between single, double, and triple knockout models

  • Molecular approach:

    • Design subtype-specific molecular probes for mRNA or protein detection

    • Use site-directed mutagenesis to identify critical residues for subtype-specific functions

    • Employ chimeric receptors to identify domains responsible for subtype-specific signaling

  • Analytical considerations:

    • Include appropriate positive and negative controls in all experiments

    • Verify receptor expression levels in experimental systems

    • Account for potential compensatory mechanisms in genetic models

What are the most reliable methods for quantifying Alpha-2A adrenergic receptor expression and activity?

Reliable quantification of Adra2a expression and activity involves several complementary methods:

MethodMeasurementAdvantagesLimitations
qRT-PCRmRNA levelsHigh sensitivity, quantitative, species-specificDoes not reflect protein levels or functionality
Western blottingProtein levelsDetects post-translational modifications, semi-quantitativeAntibody specificity issues, less sensitive
Radioligand bindingReceptor density, binding affinityDirectly measures functional receptorsRequires radioactive materials, limited throughput
Functional assays (cAMP inhibition)Receptor signalingMeasures biological activityIndirect measurement, influenced by other pathways
BRET/FRET biosensorsReal-time signaling dynamicsTemporal resolution, live cell measurementsRequires genetic modification, potential artifacts

For comprehensive characterization, researchers should combine multiple methods. For example, pairing qRT-PCR with radioligand binding assays allows correlation between gene expression and functional receptor density, while functional assays with selective ligands confirm receptor activity .

How can researchers effectively resolve data contradictions in Alpha-2A adrenergic receptor studies?

When facing contradictory data in Adra2a research, consider this systematic approach:

  • Evaluate methodological differences:

    • Expression systems: Results from recombinant systems (E. coli, yeast, baculovirus) may differ from native tissues

    • Mouse strains: Genetic background can significantly affect phenotype in knockout models

    • Ligand specificity: Ensure compounds are truly selective at concentrations used

  • Consider context-dependent effects:

    • Species differences: Mouse vs. human Adra2a may exhibit different pharmacology

    • Tissue specificity: Receptor coupling may vary between tissues

    • Experimental conditions: Temperature, pH, ionic environment can affect receptor conformation

  • Examine compensatory mechanisms:

    • Upregulation of other adrenergic receptor subtypes in knockout models

    • Alterations in downstream signaling pathways

    • Changes in receptor sensitivity or desensitization

  • Resolution strategies:

    • Perform dose-response studies across wide concentration ranges

    • Use multiple, structurally distinct ligands to confirm pharmacological profiles

    • Combine genetic and pharmacological approaches

    • Validate findings across different experimental models and tissues

What are the most common pitfalls in Adra2a signaling studies and how can they be addressed?

Common pitfalls in Adra2a signaling studies include:

  • Non-specific ligand effects:

    • Issue: Many α2 ligands lack absolute subtype selectivity

    • Solution: Use multiple structurally diverse ligands; validate with knockout models; perform careful concentration-response studies

  • Heterogeneous receptor populations:

    • Issue: Native tissues often express multiple adrenergic receptor subtypes

    • Solution: Use recombinant systems expressing only Adra2a; employ knockout models; use RNA interference to selectively reduce expression

  • G-protein coupling variability:

    • Issue: Adra2a can couple to multiple G-protein subtypes depending on context

    • Solution: Measure multiple downstream pathways (not just cAMP); use pathway-specific inhibitors; consider G-protein subtype expression

  • Receptor desensitization and internalization:

    • Issue: Prolonged agonist exposure alters receptor responsiveness

    • Solution: Use standardized exposure times; include positive controls; consider measuring receptor trafficking

  • Species differences:

    • Issue: Mouse and human receptors may have different pharmacological profiles

    • Solution: Validate key findings across species; consider using humanized mouse models

How can researchers overcome challenges in purifying functional recombinant Adra2a protein?

Purifying functional Adra2a presents several challenges, as with many G protein-coupled receptors. Here are methodological solutions:

  • Membrane protein solubilization:

    • Challenge: Maintaining native conformation during extraction from membranes

    • Solution: Use mild detergents (DDM, LMNG); add cholesterol as stabilizer; consider detergent-lipid mixed micelles

  • Expression level optimization:

    • Challenge: Low expression yields in heterologous systems

    • Solution: Optimize codon usage; use stronger promoters; consider expression as fusion protein with MBP or SUMO; test multiple expression systems (E. coli, yeast, baculovirus)

  • Protein stability:

    • Challenge: Rapid degradation during purification

    • Solution: Work at 4°C; add protease inhibitors; include ligands during purification to stabilize conformation

  • Functional verification:

    • Challenge: Ensuring purified protein retains ligand binding capability

    • Solution: Perform binding assays with radiolabeled or fluorescent ligands; verify secondary structure with circular dichroism; test G-protein coupling in reconstituted systems

  • Scale-up considerations:

    • Challenge: Maintaining quality during increased production

    • Solution: Establish robust purification protocols; implement quality control checkpoints; consider automated systems for reproducibility

What strategies can address inconsistent results between in vitro and in vivo Adra2a studies?

Bridging the gap between in vitro and in vivo Adra2a studies requires systematic approaches:

  • Physiological context reconstitution:

    • Use primary cell cultures rather than immortalized cell lines

    • Implement co-culture systems that maintain cellular interactions

    • Develop 3D culture systems that better mimic tissue architecture

  • Pharmacokinetic considerations:

    • Measure actual drug concentrations at target tissues in vivo

    • Account for protein binding, metabolism, and distribution

    • Design in vitro experiments with physiologically relevant concentration ranges

  • Compensatory mechanism evaluation:

    • Utilize inducible knockout systems to minimize developmental compensation

    • Implement acute pharmacological blockade alongside genetic models

    • Monitor expression changes in related receptors and signaling molecules

  • Translation validation pipeline:

    • Begin with recombinant systems for mechanistic studies

    • Validate in primary cells from wild-type and knockout animals

    • Confirm in ex vivo tissue preparations

    • Finally test in intact animal models under physiological conditions

  • Complementary approaches:

    • Combine genetic models (A2aARGDM) with pharmacological tools

    • Use tissue-specific conditional knockout mice to address developmental effects

    • Implement advanced imaging in both in vitro and in vivo contexts

What emerging technologies are likely to advance our understanding of Alpha-2A adrenergic receptor function?

Several cutting-edge technologies show promise for advancing Adra2a research:

  • Cryo-EM structural studies: High-resolution structures of Adra2a in different conformational states and with various ligands will enhance our understanding of receptor activation mechanisms and ligand specificity .

  • Advanced genome editing: CRISPR-Cas9 approaches for generating precise modifications in Adra2a, including point mutations that mimic human polymorphisms, will provide new insights into structure-function relationships.

  • Single-cell transcriptomics and proteomics: These techniques allow analysis of Adra2a expression and signaling at unprecedented resolution, revealing cell-specific responses and heterogeneity.

  • Optogenetic and chemogenetic tools: Development of light-activated or designer drug-activated Adra2a variants enables precise temporal control of receptor activity in specific cell populations.

  • AI-driven drug discovery: Machine learning approaches can accelerate the development of novel, highly selective Adra2a ligands by predicting binding properties and functional outcomes.

  • Organoid and microphysiological systems: These advanced 3D culture systems better recapitulate tissue architecture and function, providing more translational models for studying Adra2a signaling.

How might Alpha-2A adrenergic receptor research contribute to precision medicine approaches?

Adra2a research has significant potential to advance precision medicine through several avenues:

  • Pharmacogenomic applications:

    • Identification of genetic variants in ADRA2A that predict drug response

    • Development of genotype-guided dosing strategies for drugs targeting adrenergic pathways

    • Personalized selection of antihypertensive, analgesic, and anesthetic agents

  • Biomarker development:

    • Adra2a expression levels or polymorphisms as predictive biomarkers for disease progression

    • Receptor sensitivity measurements to guide therapeutic decision-making

    • Monitoring receptor status to evaluate treatment efficacy

  • Targeted therapeutic approaches:

    • Cell-specific delivery of Adra2a modulators using nanoparticle technology

    • Development of biased ligands that activate beneficial signaling pathways while minimizing adverse effects

    • Combination therapies targeting multiple adrenergic receptor subtypes based on individual patient profiles

  • Disease-specific applications:

    • Nervous system disorders: Personalized approaches for pain management, ADHD, and autonomic dysfunction

    • Cardiovascular conditions: Tailored antihypertensive strategies based on adrenergic receptor profiles

    • Metabolic disorders: Individualized approaches for managing sympathetic contributions to metabolic dysfunction

What are the most promising therapeutic applications emerging from Alpha-2A adrenergic receptor research?

Research using recombinant mouse Adra2a and gene disruption models has illuminated several promising therapeutic directions:

  • Neuropsychiatric applications:

    • Refined treatments for attention deficit hyperactivity disorder (ADHD)

    • Novel approaches for anxiety and stress-related disorders

    • Improved management of substance use disorders, particularly for withdrawal symptoms

  • Pain management innovations:

    • Development of α2A-selective agonists with improved side effect profiles

    • Targeted spinal cord delivery systems for enhanced analgesia

    • Combination therapies with reduced opioid requirements

  • Cardiovascular interventions:

    • Subtype-selective antihypertensive agents with minimal sedative effects

    • Novel approaches for managing heart failure through sympathetic modulation

    • Cardioprotective strategies during ischemia-reperfusion injury

  • Metabolic disease approaches:

    • α2A-targeted interventions for improving insulin sensitivity

    • Novel treatments for obesity targeting sympathetic regulation of metabolism

    • Approaches for managing hypoglycemia through adrenergic modulation

  • Anesthesia and sedation:

    • Development of improved α2A agonists building on the success of dexmedetomidine

    • Personalized anesthetic protocols based on adrenergic receptor profiles

    • Novel approaches for procedural sedation with minimal respiratory depression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.